KEGG   Mus musculus (mouse): 19219Help
Entry
19219             CDS       T01002                                 

Gene name
Ptger4, EP4, Ptgerep4
Definition
(RefSeq) prostaglandin E receptor 4 (subtype EP4)
  KO
K04261  prostaglandin E receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04924  Renin secretion
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19219 (Ptger4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    19219 (Ptger4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19219 (Ptger4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19219 (Ptger4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19219 (Ptger4)
   05165 Human papillomavirus infection
    19219 (Ptger4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19219 (Ptger4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19219 (Ptger4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL Abhydrolase_9_N
Motif
Other DBs
NCBI-GeneID: 19219
NCBI-ProteinID: NP_032991
MGI: 104311
Ensembl: ENSMUSG00000039942
Vega: OTTMUSG00000027987
UniProt: P32240
Position
15 A1; 15 1.99 cM
AA seq 513 aa AA seqDB search
MAEVGGTIPRSNRELQRCVLLTTTIMSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGN
LVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYS
TFILLFFGLSGLSIICAMSIERYLAINHAYFYSHYVDKRLAGLTLFAIYASNVLFCALPN
MGLGRSERQYPGTWCFIDWTTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHR
QFMRRTSLGTEQHHAAAAAAVASVACRGHAGASPALQRLSDFRRRRSFRRIAGAEIQMVI
LLIATSLVVLICSIPLVVRVFINQLYQPNVVKDISRNPDLQAIRIASVNPILDPWIYILL
RKTVLSKAIEKIKCLFCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTS
QTLLYLPDLTESSLGGRNLLPGSHGMGLTQADTTSLRTLRISETSDSSQGQDSESVLLVD
EVSGSHREEPASKGNSLQVTFPSETLKLSEKCI
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggttggaggtaccattcctagatcgaaccgtgagctccaacgctgtgtgtta
ctaaccaccaccatcatgtccatccccggagtcaacgcgtccttctcctccactccggag
aggctgaacagcccggtgaccattcccgcagtgatgttcatcttcggggtggtgggcaac
ctggtggccatcgtagtattgtgcaagtcgcgcaaggagcagaaagagacgaccttttac
actctagtatgtgggctggctgtcactgaccttctgggcaccttgttggtaagcccggtg
accatcgccacatacatgaagggccagtggcccggagaccaggcactgtgtgactatagc
accttcatcctacttttcttcggtctgtcgggtctcagcatcatctgtgccatgagcatc
gagcgctacctggccatcaaccacgcctacttctacagccactacgtggacaagcggctg
gccggcctcacactcttcgccatctatgcatctaacgtgctgttctgcgcgctgcccaac
atgggcctgggcagatccgagcggcagtacccgggcacctggtgcttcatcgactggacc
accaacgtaacggcctacgccgccttctcttacatgtacgccggcttcagctccttcctc
atccttgccaccgtgctctgcaacgtgctggtgtgcggcgcgctgctccgcatgcaccgc
cagttcatgcgccgcacctcgttgggcacggagcagcaccatgcggctgccgccgccgcg
gtagcttcggtggcctgtcggggccacgctggggcctccccagccctgcagcgcctcagc
gactttcgccgccgcaggagtttccggcgcatcgcgggtgcggagatccagatggtcatc
ttactcatcgccacctctctggtggtgctcatctgctccattccgctcgtggtgcgagtg
ttcattaaccagttatatcagccaaacgtggtgaaagacatcagcagaaacccagatttg
caggccatcaggattgcttctgtgaaccccatcctggacccctggatttacatccttctt
cggaagactgtgctcagtaaagccatagagaagatcaagtgcctcttctgccgcattggc
ggttccggcagagacagctcggcccagcactgctcagagagtcggaggacatcttccgcc
atgtccggccactctcgctccttcctcgcccgggagttaaaggagatcagcagcacgtcc
cagaccctcctgtacctgccagacctgactgaaagcagcctcggaggcaggaatttgctt
ccaggttcgcatggcatgggcctgacccaagcagacaccacctcgctgagaactttgcga
atttccgagacctcagactcctcccagggccaggactctgagagtgtcctgttggtggat
gaggttagtgggagccacagagaggagcctgcctctaaaggaaactctctgcaagtcaca
ttccccagtgaaactctgaaattatctgaaaaatgtatatag

DBGET integrated database retrieval system