KEGG   Mus musculus (mouse): 192212Help
Entry
192212            CDS       T01002                                 

Gene name
Prom2, AI507243, Prom-rp
Definition
(RefSeq) prominin 2
  KO
K15602  prominin 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    192212 (Prom2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   192212 (Prom2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prominin Tweety DUF2207 EI24 MscS_TM
Motif
Other DBs
NCBI-GeneID: 192212
NCBI-ProteinID: NP_620089
MGI: 2138997
Ensembl: ENSMUSG00000027376
Vega: OTTMUSG00000016031
UniProt: Q3UUY6
Position
2; 2 F1
AA seq 835 aa AA seqDB search
MTRSPGLMVPLLGLSLGLALSLPEAVTDDCGSLGRVEHLAFARVPRTRELAPLVRASGPL
NSLYGTVRRFLSVVQLNPFPAELIKTLLNDPSSVKTDEVVRYEAGYVVCAVIAGLYLLLV
PITGLCFCCCRCRQRCGGRVKTEHKAMACERGTLMIFLLLTTLVLLIGMVCAFATNQHTH
SQTGPSVKAVPETLLSLRGLVSDVPEELRAIAEQFSVPQKQVSKELDGVGENLGNVIHNR
LKSTVYPVLASVHSLGQALQVSIDHLRALNTTSVELQEAQRHLEPPVQAHRERLLALLQD
SWCHEENCKRVLSQAGALQLGADFSQTPPVDDVLHRLKDVPETNFSSMVQEEKATFNNLP
LLVQVQAVSVVKDVKKALAEQPEGLRMLAQAFPGSEAASRWSQALEGLEQRSRPYLQEVQ
QYETYRWILGCVLCSAILLVVICNLLGLSLGIWGLFAREDPSHSETKGEAGARLLMAGVA
FSFLFAVPLILLVFVTFLVGGNVQTLVCRSWESGELYEFADTPGNLPPSMNLSYLLGLKK
NISIVQAYRQCKAGAVLWKVLQLNDSYDLDKHLDIKQYTHKIQQELQSFQVDLKELDLLS
PTARQDLEALQRSGLEKIHYRGFLVQIQKPVVNTDMWQLAQELEGLAQAQNDSLLRQQLR
EEARELRSLYQEKVVPQESLVTKLNFSVKTLESLAPSLQVNTSDFLDSVTRLKGELPVQI
NHILRNATECFLTREMGYFSQYVTWVRAEVTQRIATCQPFSTALDNGHVILCDMMADPWN
AFWFCLGWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgctcacccggcctcatggtgcccctgctgggcctgagcctgggactggccctg
agcctgcccgaagctgtgacagacgactgcgggtccctcgggcgcgtggagcacctggca
ttcgctcgggtgcccaggacacgagagctggcccctcttgttcgcgcgtcggggcccctg
aactccctctatggcaccgtgcgacgattcctctccgtggttcaacttaaccccttcccg
gcagagttgataaagaccctgctgaatgacccatcttctgtgaagacagatgaggtggtt
cgatatgaggcaggctacgtggtgtgtgctgtgattgctggcctctacctcctattggtg
cccatcactgggctctgcttctgttgctgtcgctgccgccagcgctgtgggggcagagtg
aagacggagcacaaggccatggcctgtgaacgtggtaccctcatgatcttcctgctgctg
accaccctcgtgcttctgattggtatggtctgtgcttttgctacaaaccaacacacacat
agtcagacggggcccagtgtgaaagctgtccctgagaccctgctcagcctaagaggcctg
gtctctgatgtccctgaagagctgcgggccattgctgagcagttctctgtgcctcagaag
caagtctcaaaggagctggatggtgttggtgagaaccttgggaacgtaattcataaccgg
ctcaagagcacagtgtacccagtgctagcctcagtgcacagcctgggccaggccctgcag
gtctccatagaccaccttcgagccctgaacaccacctcagtggagctgcaggaggctcag
cggcacctggagccacctgtgcaggcgcaccgggaacgcctgctcgccctgcttcaggac
agctggtgccacgaggagaattgcaagcgggtgctcagccaggccggtgctctgcaactg
ggcgctgactttagccagacgccccctgtggatgatgtcctgcatcggctgaaggatgtc
ccagaaaccaacttctccagcatggtccaggaggagaaagccaccttcaataacctcccg
ctcctggttcaagtgcaggcggtcagtgtggtcaaagatgtgaaaaaggcactggctgag
cagcctgaagggttgaggatgctggcccaagcgttcccaggttcagaggcagcctcccgc
tggagccaggcactggaggggctggaacagcgcagccgcccctacttgcaggaggtgcaa
caatatgagacatacaggtggattttgggatgcgtgctgtgctctgccatcctgcttgtg
gtgatctgtaacctgctgggcctcagcctgggcatctgggggttgtttgccagggaggac
cccagccactctgaaaccaagggcgaggctggagcccgcctcctcatggcaggtgtggcc
ttcagcttcctcttcgcagtccccctcatcctcctcgtcttcgtcactttcctggtgggt
ggcaatgtgcagacgctggtgtgccggagctgggagagtggagagctgtatgagtttgca
gacactccggggaacttgccaccatccatgaacctatcctatcttcttggcctgaagaaa
aacatcagcatcgtccaggcctatcgacagtgtaaggcaggggcagtactctggaaggtt
ctacagctcaatgactcgtatgacctggataagcacctggatatcaaacagtatacccac
aagattcagcaggagcttcagagcttccaagtagatttgaaggagctagacctgttgagc
cccactgcccgccaggacctggaggctttgcagaggagcgggctggagaaaatccactac
agaggcttccttgtgcagatccagaagcctgtggtgaacactgacatgtggcagctggcg
caggagctggaaggactggcccaggcccaaaatgactctttactgaggcagcagctacgg
gaggaggccagagaacttcgaagcctctaccaggagaaggttgtcccccaggagagcctt
gtgaccaagctcaacttcagtgtcaagaccttggagtccttggccccaagtctgcaggtg
aatacctcagactttcttgacagtgtcactcgtctaaaaggagagctgcctgtgcagatc
aaccacatcctgaggaatgccactgagtgtttcctgaccagggaaatgggctacttctct
cagtatgtgacctgggtgagagcagaggtgactcagcgcatcgccacctgccagcccttc
tctacagccctggacaatggtcatgtgatcctgtgtgacatgatggctgacccctggaac
gccttctggttttgcctggggtggtgcaccttcttcctcatccccagcatcatcttcgct
gtcaagacctccaagtacttccgtcccatccggaaacgcctcagctccaccagctctgaa
gagacacaacttttccatatccccagggtcacctctctgaagctatag

DBGET integrated database retrieval system