KEGG   Mus musculus (house mouse): 192216
Entry
192216            CDS       T01002                                 
Symbol
Tmem47, 3010015F07Rik, AI115536, BCMP1, Tm4sf10
Name
(RefSeq) transmembrane protein 47
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PMP22_Claudin Yip1 Claudin_3 Clc-like TMEM173 ApoO Claudin_2
Other DBs
NCBI-GeneID: 192216
NCBI-ProteinID: NP_620090
MGI: 2177570
Ensembl: ENSMUSG00000025666
UniProt: Q9JJG6
Position
X:80114250..80141481
AA seq 181 aa
MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK
PANLDIWHCESTLGSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF
AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY
Y
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcttcggctggcagcggcatggaagaggtgcgagtgtcggtgctgaccccgctcaag
ctggtcgggctggtgtgcatcttcttggcgctgtgtctggatctgggagctgttctgagc
ccggcctgggtcaccgcggaccaccagtactacctgtccctgtgggagtcctgccggaaa
cccgccaacctggatatctggcattgcgaatccactctcggcagcgattggcagattgct
actctggctttactcctgggcggtgctgccatcattctcattgcattcctggtgggtttg
atttcaatctgtgtgggatcacgaaggcgcttctacagacctgttgctgtcatgcttttt
gcagcagttgttttgcaggtctgcagcctggttctttatccaatcaagttcattgaaact
gtgagcttgaaaatttaccacgagttcaattggggttatggcctggcctggggtgcaact
atattttcatttgggggtgccattctttattgcctgaaccctaagaactatgaagactac
tactaa

DBGET integrated database retrieval system