KEGG   Mus musculus (mouse): 192236
Entry
192236            CDS       T01002                                 

Gene name
Hps1, 6030422N11Rik, BB405864, Gm21361, Hps, ep
Definition
(RefSeq) HPS1, biogenesis of lysosomal organelles complex 3 subunit 1
  KO
K20193  Hermansky-Pudlak syndrome 1 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    192236 (Hps1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   BLOC-3 complex
    192236 (Hps1)
SSDB
Motif
Pfam: Fuz_longin_2 Fuz_longin_1 Fuz_longin_3
Other DBs
NCBI-GeneID: 192236
NCBI-ProteinID: NP_062297
MGI: 2177763
Ensembl: ENSMUSG00000025188
Vega: OTTMUSG00000032530
UniProt: O08983 A0A0R4J062
Position
19 C3; 19 36.56 cM
AA seq 704 aa
MKCVLVATEGAEVLFYWTDEEFAESLRLKLQQSEDEEEELPVLEDQLSTLLAPVIISSMT
MMEKLSDTYTCFSTENDNHLYVLHLFGEYLFVAINGDHSESEGDLRRKLCVLKYLFEVHF
GLVTVDGQLIRKELRPPDLEERARVWKHFQRLLGTYSYLRDREQSFAVEAVERLIHPQLC
EQSIETLERHVVQAINASPERGGEEVLHAFLLVHCKLLAFYSGHGASTLRPADLLALILL
VQDLQPSPGTTEEEEEEEDSDSPQRRPKSSQNIPVQQARSQSTSVPTRSSRETDTDSISL
PEEYFTPAPSPGDQSSGSLVWLDGGTPPSDALQMAEDTPEGLASHSPELPSPRRIFLDAN
IKENYCPLVPHTMYCLPLWPGINMVLLTKSPSTPLALILYQLLDGFSLLEKKLKEGQEAG
SALRSQPFVADLRQKMDKFIKNRVGQEIQNTWLEFKSKAFSRSEPGSSWELLQVCGKLKR
QLCVIYRLSFLVTAPSRGGPHLPQHLQDRAQKLMKERLLDWKDFLLVKSRRNVTMVSYLE
DFPGLVHFIYVDRTTGQMVAPSLSPNEKMSSELGKGPLAAFVKAKVWALVRLARRYLQKG
CTTLLFQEGDFRCSYFLWFENDMGYKLQMIEVPVLSDDSVPIGVLGGDYYRKLLRYYSKS
HPSEPVRCYELLTLHLSVIPTDLLVQQASQLARRLGEASRVTLP
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgaagtgcgtgttggtggccaccgagggcgcagaggtcctcttctactggacagatgag
gagtttgctgagagcctccggctgaagctccagcagtcagaggatgaggaagaggagctc
cctgtgctggaggaccagctcagcaccctcctggccccagtcatcatctcctccatgacg
atgatggagaagctctcggacacatatacctgcttctcaacagaaaatgacaaccacctg
tatgtcctgcatctgtttggagagtacctgttcgtcgccatcaacggagaccacagtgag
agcgagggggacctgcggaggaaactgtgtgtgctcaagtatctattcgaggtgcacttc
gggctggtgactgtggacggccagctcatccggaaggagcttcgtccacccgacctggaa
gagcgtgcccgggtgtggaagcactttcagagactgctggggacctacagctacctgcgg
gaccgggagcagagctttgctgtggaggcagtggagcggctcattcacccccagctctgc
gaacagagcatcgagacgctagagcggcacgtggttcaagccatcaacgccagccccgag
cggggcggtgaagaggtcctgcacgccttcctgctggtgcactgcaagctgttggctttc
tactccggccatggtgcgagcaccctgcgccccgcagacctcctggcgctcatccttctg
gtgcaggacctccagccctccccaggaaccacagaggaggaggaggaggaggaggatagc
gacagccctcagaggagacccaagagcagccaaaacatcccagtgcagcaggcaaggagc
cagagcacctcagtccccaccaggagttccagggagacagacacagacagcatctccctc
cctgaagagtacttcactcctgctccttccccaggcgatcagagttcaggtagcctcgtc
tggctggatggtggcaccccgcccagcgatgctcttcagatggctgaggacacccccgag
gggctggcgtctcactccccagaacttcccagccccagaaggatcttcctggatgccaac
ataaaagaaaactactgtcccttagtgccccacaccatgtactgcctgcccctgtggcca
ggcatcaacatggtgctgctgaccaagagccccagcaccccactggccctgatcctgtac
caactgctggatggcttctccctcctggagaaaaagctgaaggaaggtcaggaggccgga
agtgccctgcgatcccagccctttgttgcagacctgcgccagaagatggacaagtttatc
aagaatcgagttgggcaggagattcagaacacctggctggagtttaagagcaaagccttc
tctagaagtgagccaggatcgtcctgggagctgctccaggtctgtggaaagctgaagcga
cagctgtgtgtcatctaccggcttagcttcctggtcactgcacccagcagaggaggaccg
cacctgccccagcacctgcaggaccgagcccagaaactcatgaaggagaggcttctggac
tggaaggacttcctgttggtgaagagccggagaaatgtcaccatggtgtcctacctggag
gatttcccaggcctggtccacttcatctatgtggaccgtacaaccgggcagatggtggcc
ccctctctcagccccaacgaaaagatgtcttccgagttgggcaaggggcccctggctgcc
tttgtcaaagccaaggtctgggctctggtccgactggcgcgcaggtacctgcagaagggc
tgcaccacactgctgttccaggaaggggacttccgctgctcctacttcctgtggttcgag
aatgacatgggatacaaactgcagatgattgaggtgcctgtcctctcggatgactccgtc
cccattggcgtgctgggaggtgactactacaggaaacttctgcgctactacagcaagagc
cacccctcggagcccgtcaggtgctatgagctgctcacgctgcatctgtccgtcatcccc
acggacctgctggtgcagcaggccagccagctggcccggcgcctgggggaggcctcccgg
gtgaccctgccctag

DBGET integrated database retrieval system