KEGG   Mus musculus (mouse): 19228
Entry
19228             CDS       T01002                                 

Gene name
Pth1r, PPR, PTH, Pthr, Pthr1
Definition
(RefSeq) parathyroid hormone 1 receptor
  KO
K04585  parathyroid hormone receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19228 (Pth1r)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    19228 (Pth1r)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    19228 (Pth1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19228 (Pth1r)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Calcium-regulating peptide
   Parathyroid hormone
    19228 (Pth1r)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 19228
NCBI-ProteinID: NP_001077404
MGI: 97801
Ensembl: ENSMUSG00000032492
Vega: OTTMUSG00000052494
UniProt: P41593
Position
9 F2; 9 60.56 cM
AA seq 591 aa
MGTARIAPSLALLLCCPVLSSAYALVDADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAA
NIMESDKGWTPASTSGKPRKEKAPGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETRE
REVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVK
DAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK
WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVH
YTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRAGLSLPLSPRLLPATTNGHSQLPGHAKPG
APAIENETIPVTMTVPKDDGFLNGSCSGLDEEASGSARPPPLLQEEWETVM
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggggaccgcccggatcgcacccagcctggcgctccttctctgctgcccagtgctcagc
tccgcatatgcgctggtggacgcagacgatgtctttaccaaagaggaacagattttcctg
ctgcaccgtgcccaggcgcaatgtgacaagctgctcaaggaagttctgcacacagcagcc
aacataatggagtcagacaaagggtggacgccagcatctacgtcagggaagcccaggaaa
gagaaggcaccgggaaagttctaccccgagtctaaagagaacaaggatgtgcccaccggc
agcaggcgccgagggcgtccctgtctgccagagtgggacaacatcgtttgctggccattg
ggggcaccaggtgaagtggtggcagtaccttgtcccgattacatttatgacttcaaccac
aaaggccatgcctacagacgctgcgaccgcaatggcagctgggaggtggttccagggcac
aaccggacgtgggccaactacagcgagtgcctcaagttcatgaccaatgagactcgggaa
cgggaggtatttgaccgcctgggcatgatctacaccgtgggatattccatgtctcttgcc
tccctcaccgtggctgtgctcatcctagcctattttaggcggctgcactgcacgcgcaac
tacatccacatgcacatgttcctgtcgtttatgctgcgcgccgcgagcatcttcgtgaag
gacgctgtgctctactctggcttcacgctggatgaggccgagcgcctcacggaggaagag
ttgcatatcatcgcgcaggtgccgcctccgcccgccgctgccgccgttggctacgctggc
tgccgtgtggccgtgaccttcttcctctacttcctggctaccaactactactggattctg
gtggagggactgtacttacacagcctcatcttcatggcctttttctcagagaagaagtat
ctgtggggcttcaccatctttggctggggtctgccggctgtcttcgtggctgtgtgggtc
ggtgtcagagcaaccttggccaacactgggtgctgggacctgagctctgggcacaagaag
tggatcatccaggtgcccatcctggcatctgttgtgctcaacttcatcctctttatcaac
atcatccgggtgcttgccactaagcttcgggagaccaatgcgggccggtgtgacaccagg
cagcagtaccggaagctgctcaggtccacgttggtgcttgtgccactcttcggtgtccac
tacaccgtcttcatggccttgccgtacaccgaggtctcagggacactgtggcagatccag
atgcactatgagatgctcttcaactccttccagggattttttgttgccatcatatactgt
ttctgcaatggtgaggtgcaggcagagattaggaagtcttggagccgctggacactggca
ttggacttcaagcgtaaagcacgaagtgggagtagcagctacagctatggcccaatggtg
tcacacacgagtgtgaccaatgtgggcccccgtgcaggactcagccttccccttagcccc
cgcctgcttcctgccaccaccaatggccactcccagctgcctggccacgccaagccgggc
gctccagccattgagaacgaaaccataccagttactatgacagttcccaaggacgacggc
ttccttaatggctcctgctcgggtctggatgaggaggcctctgggtctgcgcggccacct
ccattgttgcaggaagaatgggaaacagtcatgtga

DBGET integrated database retrieval system