KEGG   Mus musculus (mouse): 192287Help
Entry
192287            CDS       T01002                                 

Gene name
Slc25a36, C330005L02Rik
Definition
(RefSeq) solute carrier family 25, member 36
  KO
K15116  solute carrier family 25, member 33/36
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    192287 (Slc25a36)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   192287 (Slc25a36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 192287
NCBI-ProteinID: NP_620095
MGI: 1924909
Ensembl: ENSMUSG00000032449
Vega: OTTMUSG00000031601
UniProt: Q922G0
Position
9; 9 E3.3
AA seq 311 aa AA seqDB search
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVV
SPGPLHCLKAILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQV
HMASAAMAGFTAITATNPIWLIKTRLQLDARTRGEKQMGAFECVRKVYQTDGLRGFYRGM
SASYAGISETVIHFVIYESIKQKLLECKTASMMETDEESVKEASDFVRMMLAAATSKTCA
TTIAYPHEVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLYRGLTTHLVRQIPNTAIMMA
TYELVVYLLNG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagggacacgctggtgcatctgtttgccgggggatgtggtggcacagtggga
gctattctgacatgtccactggaagttgtcaaaacacggctgcagtcttcttctgtgaca
ctgtatatttctgaagttcagctgaacaccatggctggagccagtgtgaaccgagtagtg
tcccctggacctcttcattgtctgaaggctatcctggaaaaagagggccctcgctcgttg
tttagaggattgggccccaatttggtgggggttgctccctccagagcaatatactttgct
gcttattcaaactgcaaggaaaagttgaatggtgtttttgatcctgattctacccaagtg
cacatggcttcagctgcaatggcaggttttactgcaatcactgcaacaaaccccatttgg
cttataaagactcgcttacagcttgatgcaaggactcgtggggaaaagcaaatgggtgct
tttgaatgtgttcgtaaagtctatcagacagacggactgcgaggattttataggggcatg
tctgcctcctatgccggcatatcagagactgttatccattttgttatttatgaaagtata
aagcaaaaactactggaatgtaagactgcttctatgatggaaactgatgaggagtctgtg
aaagaagcatcggattttgtgagaatgatgctagctgctgccacctcaaaaacctgtgcc
acaaccatagcgtatccacacgaagttgtaagaacaagactacgtgaagaagggacaaaa
tataggtctttttttcaaacattgtctttgattgttcaagaagaaggctatggatctctt
taccgcggtctaacaactcatctggtgaggcagattccaaacacggccattatgatggcc
acctacgaactggtggtctaccttctcaacggatag

DBGET integrated database retrieval system