KEGG   Mus musculus (mouse): 19230
Entry
19230             CDS       T01002                                 

Gene name
Twf1, A, A6, Ptk, Ptk9, Twinf, twi, twinfilin
Definition
(RefSeq) twinfilin actin binding protein 1
  KO
K08870  twinfilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    19230 (Twf1)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 19230
NCBI-ProteinID: NP_032997
MGI: 1100520
Ensembl: ENSMUSG00000022451
Vega: OTTMUSG00000017538
UniProt: Q91YR1
Structure
PDB: 
1M4J 3DAW 2HD7 2D8B

Position
15; 15 E3
AA seq 350 aa
MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVVGSCSPPSDSWEQDYDSFVLPL
LEDKQPCYVLFRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDE
VFGTVKEDVSLHGYKKYLLSQSSPAPLTAAEEELRQIKINEVQTDVSVDTKHQTLQGVAF
PISRDAFQALEKLSKKQLNYVQLEIDIKNETIILANTENTELRDLPKRIPKDSARYHFFL
YKHSHEGDYLESVVFIYSMPGYTCSIRERMLYSSCKSPLLEIVERQLQMDVIRKIEIDNG
DELTADFLYDEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAEAEATTD
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtcccaccagacaggcatccaagcaagcgaagatgtcaaagagatctttgcccgagcc
agaaacgggaaatacagacttctgaaaatatctatcgaaaatgagcaactggtggttggc
tcctgtagtccaccttcagactcctgggaacaggactacgactcctttgtcttgcccctg
ctggaggacaagcagccgtgctatgtattattcaggttagactctcagaatgcccaggga
tatgaatggatattcattgcatggtctccagatcattctcatgtacgtcagaaaatgctg
tatgcggcaacaagagcgactctgaagaaagaatttggaggtggccacattaaagatgaa
gtgtttggaacagtaaaggaggacgtatcattacatggatataaaaagtatttgctgtcc
cagtcttcccctgccccgctgaccgccgctgaggaagaattacggcagattaaaatcaac
gaggtccaaactgatgtgagtgtggacacaaagcaccagacactccaaggcgtagccttt
cctatttctcgagatgccttccaggctttggagaagctgagtaagaagcagctcaactat
gtgcagttggaaatagatataaaaaatgaaacaataattttggccaacacagaaaataca
gaactgagagatttgccaaagaggattcccaaggattcagcgcgttaccatttctttctg
tacaagcattcccacgaaggagactacttagagtccgtagtttttatttattcgatgcct
ggatacacgtgcagcataagagagcggatgctgtattccagctgcaagagccctctgctc
gagattgtagagcgacagctacagatggatgtgatcagaaagattgagatagacaatggg
gatgagctgactgcggatttcctgtacgatgaagtccaccccaagcagcatgcacataag
cagagttttgctaaaccgaaaggtcctgcgggaaagagggggatccgaagattgattagg
ggcccagcggaagcagaagccactactgactag

DBGET integrated database retrieval system