KEGG   Mus musculus (mouse): 19242Help
Entry
19242             CDS       T01002                                 

Gene name
Ptn, HARP, HB-GAM, HBBM, HBBN, HBGF-8, HBNF, OSF, Osf-1, Osf1
Definition
(RefSeq) pleiotrophin
  KO
K16642  pleiotrophin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    19242 (Ptn)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   19242 (Ptn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTN_MK_C PTN_MK_N
Motif
Other DBs
NCBI-GeneID: 19242
NCBI-ProteinID: NP_032999
MGI: 97804
Ensembl: ENSMUSG00000029838
Vega: OTTMUSG00000056195
UniProt: P63089
Position
6 B1; 6 15.48 cM
AA seq 168 aa AA seqDB search
MSSQQYQQQRRKFAAAFLALIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccagcaatatcagcagcaacgtagaaaatttgcagctgccttcctggcattg
attttcatcttggcagctgtggacactgctgaggccgggaagaaagagaaacctgaaaaa
aaggtgaaaaagtctgactgtggagaatggcagtggagtgtgtgcgtgcctaccagcggg
gactgtggattgggcacccgggagggcactcgcactggcgccgagtgcaaacagaccatg
aagactcagagatgtaagatcccttgcaactggaagaagcagtttggagctgagtgcaag
taccagttccaggcttggggagaatgtgacctcaataccgccttgaagaccagaactggc
agcctgaagcgagctctgcacaatgctgactgtcagaaaactgtcaccatctccaagccc
tgtggcaagctcaccaagcccaagcctcaagcggagtcaaagaagaagaaaaaggaaggc
aagaaacaggagaagatgctggattaa

DBGET integrated database retrieval system