KEGG   Mus musculus (mouse): 19243
Entry
19243             CDS       T01002                                 

Symbol
Ptp4a1, AA415290, AU019864, C130021B01, Prl-1
Name
(RefSeq) protein tyrosine phosphatase 4a1
  KO
K18041  protein tyrosine phosphatase type IVA [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19243 (Ptp4a1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19243 (Ptp4a1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase of regenerating liver (PRL)
    19243 (Ptp4a1)
SSDB
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase ALS_ss_C
Other DBs
NCBI-GeneID: 19243
NCBI-ProteinID: NP_035330
MGI: 1277096
Ensembl: ENSMUSG00000026064 ENSMUSG00000117310
Vega: OTTMUSG00000021326
UniProt: Q63739 B9EKL6
Structure
Position
1:complement(30979384..30988846)
AA seq 173 aa
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
NT seq 522 nt   +upstreamnt  +downstreamnt
atggctcgaatgaaccgccctgctcctgtggaagtcacatacaagaacatgcgatttctt
attacacacaatccaaccaatgcgaccttaaacaaatttatagaggaacttaagaagtat
ggagttaccacaatagtaagagtatgtgaagcaacttacgacactactcttgtggagaaa
gaaggcattcatgttcttgactggccttttgatgatggtgcaccaccatccaaccagatt
gtcgatgactggctaagtcttgtgaagattaagtttcgtgaagaacctggttgctgtatt
gctgtccattgtgtcgcaggccttggcagagctccggtgcttgttgccctagcattaatt
gaaggtggaatgaaatatgaagatgcagtacaattcataagacaaaagcggcgtggagct
tttaacagcaagcaacttttgtatctggagaagtaccgtccgaaaatgcggctccgcttc
aaggattccaatggtcatagaaacaactgttgtattcaataa

DBGET integrated database retrieval system