KEGG   Mus musculus (mouse): 19246Help
Entry
19246             CDS       T01002                                 

Gene name
Ptpn1, PTP-1B, PTP-HA2, PTP1B
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 1
  KO
K05696  tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04520  Adherens junction
mmu04910  Insulin signaling pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    19246 (Ptpn1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19246 (Ptpn1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    19246 (Ptpn1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19246 (Ptpn1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19246 (Ptpn1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    19246 (Ptpn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 TUDOR_5
Motif
Other DBs
NCBI-GeneID: 19246
NCBI-ProteinID: NP_035331
MGI: 97805
Ensembl: ENSMUSG00000027540
Vega: OTTMUSG00000015956
UniProt: P35821 Q3TZW9
Position
2; 2 H3
AA seq 432 aa AA seqDB search
MEMEKEFEEIDKAGNWAAIYQDIRHEASDFPCKVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLK
CAQYWPQQEEKEMVFDDTGLKLTLISEDVKSYYTVRQLELENLTTKETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSREDLD
LPPEHVPPPPRPPKRTLEPHNGKCKELFSSHQWVSEETCGDEDSLAREEGRAQSSAMHSV
SSMSPDTEVRRRMVGGGLQSAQASVPTEEELSSTEEEHKAHWPSHWKPFLVNVCMATLLA
TGAYLCYRVCFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagaaggagttcgaggagatcgacaaggctgggaactgggcggctatttac
caggacattcgacatgaagccagcgacttcccatgcaaagtcgcgaagcttcctaagaac
aaaaaccggaacaggtaccgagatgtcagcccttttgaccacagtcggattaaattgcac
caggaagataatgactatatcaatgccagcttgataaaaatggaagaagcccagaggagc
tatattctcacccagggccctttaccaaacacatgtgggcacttctgggagatggtgtgg
gagcagaagagcaggggcgtggtcatgctcaaccgcatcatggagaaaggctcgttaaaa
tgtgcccagtattggccacagcaagaagaaaaggagatggtctttgatgacacaggtttg
aagttgacactaatctctgaagatgtcaagtcatattacacagtacgacagttggagttg
gaaaacctgactaccaaggagactcgagagatcctgcatttccactacaccacatggcct
gactttggagtccccgagtcaccggcttctttcctcaatttccttttcaaagtccgagag
tcaggctcactcagcctggagcatggccccattgtggtccactgcagcgccggcatcggg
aggtcagggaccttctgtctggctgacacctgcctcttactgatggacaagaggaaagac
ccatcttccgtggacatcaagaaagtactgctggagatgcgcaggttccgcatggggctc
atccagactgccgaccagctgcgcttctcctacctggctgtcatcgagggcgccaagttc
atcatgggcgactcgtcagtgcaggatcagtggaaggagctctcccgggaggatctagac
cttccacccgagcacgtgcccccacctccccggccacccaaacgcacactggagcctcac
aacgggaagtgcaaggagctcttctccagccaccagtgggtgagcgaggagacctgtggg
gatgaagacagcctggccagagaggaaggcagagcccagtcaagtgccatgcacagcgtg
agcagcatgagtccagacactgaagttaggagacggatggtgggtggaggtcttcaaagt
gctcaggcgtctgtccccaccgaggaagagctgtcctccactgaggaggaacacaaggca
cattggccaagtcactggaagcccttcctggtcaatgtgtgcatggccacgctcctggcc
accggcgcgtacttgtgctaccgggtgtgttttcactga

DBGET integrated database retrieval system