KEGG   Mus musculus (mouse): 19247Help
Entry
19247             CDS       T01002                                 

Gene name
Ptpn11, 2700084A17Rik, AW536184, PTP1D, PTP2C, SAP-2, SH-PTP2, SH-PTP3, SHP-2, Shp2, Syp
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04360  Axon guidance
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04931  Insulin resistance
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05220  Chronic myeloid leukemia
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19247 (Ptpn11)
   04630 Jak-STAT signaling pathway
    19247 (Ptpn11)
   04072 Phospholipase D signaling pathway
    19247 (Ptpn11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19247 (Ptpn11)
   04650 Natural killer cell mediated cytotoxicity
    19247 (Ptpn11)
   04670 Leukocyte transendothelial migration
    19247 (Ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    19247 (Ptpn11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    19247 (Ptpn11)
  09158 Development and regeneration
   04360 Axon guidance
    19247 (Ptpn11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19247 (Ptpn11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19247 (Ptpn11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    19247 (Ptpn11)
   05211 Renal cell carcinoma
    19247 (Ptpn11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    19247 (Ptpn11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    19247 (Ptpn11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19247 (Ptpn11)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19247 (Ptpn11)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    19247 (Ptpn11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase Tab2_like
Motif
Other DBs
NCBI-GeneID: 19247
NCBI-ProteinID: NP_035332
MGI: 99511
Ensembl: ENSMUSG00000043733
Vega: OTTMUSG00000016267
UniProt: P35235
Structure
PDB: 

Position
5; 5 F
AA seq 597 aa AA seqDB search
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcaccccaacatcactggtgtggaggcagagaatctcctg
ctgaccagaggagtcgatggcagttttttagcaaggcccagtaagagtaaccctggagac
ttcactctgtctgttagaagaaatggagctgttacccacatcaagattcagaacactggg
gactactatgacctctatggtggggagaagtttgccactttggctgaactggttcagtat
tacatggaacaccatgggcagctgaaagagaagaatggagatgttatcgagctcaagtac
ccgctgaactgtgcagaccctacctctgaaaggtggttccatggtcacttgtctggaaaa
gaagcagagaagctgctgacggagaagggcaagcatggcagcttcctcgttcgagagagc
cagagccaccccggagacttcgttctctccgtgcgcactggtgacgacaaaggggagagc
aacgacggcaagtccaaagtgacccacgtcatgatccgctgtcaggagctgaaatacgac
gttggtgggggagagcgctttgactctctgacagacctggtggagcattacaagaagaac
cccatggtggagacgctgggcacagtcctgcagctcaagcagcccctcaacacaactcgt
atcaatgctgctgaaattgaaagccgggttcgagagttaagcaagctggctgagaccaca
gataaagtcaagcagggcttttgggaagagtttgagacgctccagcaacaggaatgcaaa
cttctctatagccgaaaagaaggacagagacaagaaaataaaaacaaaaacagatacaaa
aacatcctgccctttgatcataccagggtcgttctgcatgatggggatcccaatgagcct
gtttctgattacattaatgcaaacatcatcatgcctgagtttgagaccaagtgcaacaat
tccaaacccaaaaagagttacattgccactcaaggctgcctgcagaacacggtgaatgac
ttctggcggatggtgttccaggagaactctcgagtcattgtcatgaccacaaaggaagtg
gagagagggaagagcaaatgtgtcaagtactggcctgatgagtatgcgctcaaagaatac
ggggtcatgcgtgttaggaacgtcaaagaaagtgccgcccatgactacactttacgagag
ctcaaactctctaaggtcggacaagctctactccagggaaacacagagagaaccgtctgg
cagtaccactttcggacctggccagaccatggcgtgcctagtgaccctggaggtgtgctg
gacttcctggaggaggtccaccacaagcaggagagcatcgtggatgcaggccctgtcgtg
gttcactgcagcgctgggattggccggacaggaaccttcattgtgattgacatccttatt
gacatcattcgagagaaaggtgtggactgtgacatcgacgttcctaaaaccattcagatg
gtgcggtcccagaggtcggggatggtccagacagaagcacagtaccggtttatctacatg
gctgtccagcactacatagagacgctgcagcgccggatcgaggaggagcagaaaagcaaa
agaaaaggacatgaatataccaatattaagtattccttggtggaccagacaagtggtgat
cagagtcccctgccaccctgcaccccaacgccaccctgtgcagaaatgagggaggacagc
gcccgagtctatgagaacgtgggcctcatgcagcagcagaggagtttcagatga

DBGET integrated database retrieval system