KEGG   Mus musculus (mouse): 19255
Entry
19255             CDS       T01002                                 

Gene name
Ptpn2, AI325124, Pt, Ptpt, TC-P, TC-PTP
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19255 (Ptpn2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19255 (Ptpn2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19255 (Ptpn2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    19255 (Ptpn2)
SSDB
Motif
Pfam: Y_phosphatase DSPc CHASE3 Y_phosphatase3
Other DBs
NCBI-GeneID: 19255
NCBI-ProteinID: NP_001120649
MGI: 97806
Ensembl: ENSMUSG00000024539
Vega: OTTMUSG00000029831
UniProt: Q06180
Position
18; 18 E1
AA seq 406 aa
MSATIEREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQSTENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKES
VKCAQYWPTDDREMVFKETGFSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGCLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGE
DVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTKGDSNIQKRWKELSKEDLSPI
CDHSQNRVMVEKYNGKRIGSEDEKLTGLPSKVQDTVEESSESILRKRIREDRKATTAQKV
QQMKQRLNETERKRKRWLYWQPILTKMGFVSVILVGALVGWTLLFH
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcggcaaccatcgagcgggagttcgaggaactggatgctcagtgtcgctggcagccg
ttatacttggaaattcgaaatgaatcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaaccgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaagtactgaaaatgattatattaatgccagcttagttgacatagaagaggcacaa
agaagttacatcttaacacagggcccacttccgaacacatgctgccatttctggctcatg
gtgtggcagcaaaagaccaaagcagttgtcatgctaaaccgaactgtagaaaaagaatcg
gttaaatgtgcacagtactggccaacggatgacagagaaatggtgtttaaggaaacggga
ttcagtgtgaagctcttatctgaagatgtaaaatcatattatacagtacatctactacag
ttagaaaatatcaatactggtgaaaccagaaccatatctcacttccattataccacctgg
ccagattttggggttccagagtcaccagcttcatttctaaacttcttgtttaaagttaga
gaatctggttgtttgacccctgaccatggacctgcagtgatccattgcagtgcgggcatc
gggcgctctggcaccttctctcttgtagatacctgtcttgttctgatggaaaaaggagag
gatgttaatgtgaaacaattattactgaatatgagaaagtatcgaatgggacttattcag
acaccggaccaactcagattctcctacatggccataatagaaggagcaaagtacacaaaa
ggagattcaaatatacagaaacggtggaaagaactttctaaagaagatttatctcctatt
tgtgatcattcacagaacagagtgatggttgagaagtacaatgggaagagaataggttca
gaagatgaaaagttaacagggcttccttctaaggtgcaggatactgtggaggagagcagt
gagagcattctacggaaacgtattcgagaggatagaaaggctacgacggctcagaaggtg
cagcagatgaaacagaggctaaatgaaactgaacgaaaaagaaaaaggtggttatattgg
caacctattctcactaagatggggtttgtgtcagtcattttggttggcgctttggttggc
tggacactgctttttcactaa

DBGET integrated database retrieval system