KEGG   Mus musculus (mouse): 19256
Entry
19256             CDS       T01002                                 

Symbol
Ptpn20, typ
Name
(RefSeq) protein tyrosine phosphatase, non-receptor type 20
  KO
K18039  tyrosine-protein phosphatase non-receptor type 20 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19256 (Ptpn20)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19256 (Ptpn20)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    19256 (Ptpn20)
SSDB
Motif
Pfam: Y_phosphatase Y_phosphatase3 DSPc PTPlike_phytase
Other DBs
NCBI-GeneID: 19256
NCBI-ProteinID: NP_033004
MGI: 1196295
Ensembl: ENSMUSG00000021940
UniProt: O55082
Position
14:33311150..33362711
AA seq 426 aa
MSSPRKVRGKTGRDNDEEEGNSGNLNLRNSLPSSSQKMTPTKPIFGNKMNSENVKPSHHL
SFSDKYELVYPEPLESDTDETVWDVSDRSLRNRWNSMDSETAGPSKTVSPVLSGSSRLSK
DTETSVSEKELTQLAQIRPLIFNSSARSAMRDCLNTLQKKEELDIIREFLELEQMTLPDD
FNSGNTLQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEYFYIATQGPLPE
TIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLETFHVTQY
FTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCS
AGVGRTGVFICVDVVFSAIEKNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVLQ
NLLALY
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcttcacccaggaaggttagaggaaaaactggaagagataatgatgaagaggagggt
aattcaggtaacctgaatctccgcaactctttgccttcatcgagtcagaaaatgacgcct
acgaagccgatttttgggaataaaatgaattcagagaatgtaaaaccctcccatcacctg
tcattctcagataagtatgagcttgtttacccagagcctttggaaagtgacactgatgag
actgtgtgggatgtcagtgaccggtctctcagaaacaggtggaacagtatggattcagag
actgcagggccgtcaaagactgtctccccagtgctttctggtagtagtaggctctcaaag
gacactgaaacatctgtctctgaaaaggagctaactcagttggctcagattcgaccatta
atattcaacagttctgcacggtctgctatgcgggattgtttgaacacgcttcagaaaaaa
gaagaacttgatatcatccgtgagtttttggagttagaacaaatgactctgcctgatgac
ttcaattctgggaatacactacagaacagagataagaacagataccgagatattcttcca
tatgattcaacacgtgttcctcttggaaaaaacaaggactacatcaacgctagttatatt
agaatagtaaatcatgaagaagagtatttttatattgccactcaaggaccattgccagaa
actatagaagacttttggcaaatggttctggaaaataattgtaatgttattgctatgata
accagagagatagaatgtggagttatcaagtgttacagttactggcccatttctctgaag
gagcctttggaattcgaacactttagtgtctttctggagacctttcatgtaactcaatat
ttcaccgttcgagtatttcagattgtgaagaagtccacaggaaagagccaatgtgtaaaa
cacttgcagttcaccaagtggccagaccatggcactcctgcctcagcagattttttcata
aaatatgtccgttatgtgaggaagagccacattacaggacccctccttgttcactgcagt
gctggtgtaggccgaacaggggtgttcatatgtgtggatgttgtgttctctgccatcgag
aagaactactcttttgacattatgaacatagtgacccagatgagaaagcagcgctgtggc
atgattcaaaccaaggagcagtaccagttttgttatgaaattgtgcttgaagttcttcag
aaccttctggctttgtattaa

DBGET integrated database retrieval system