KEGG   Mus musculus (mouse): 19261Help
Entry
19261             CDS       T01002                                 

Gene name
Sirpa, AI835480, Bit, CD172a, P84, Ptpns1, SHP-1, SHPS-1, SIRP
Definition
(RefSeq) signal-regulatory protein alpha
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    19261 (Sirpa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    19261 (Sirpa)
   04090 CD molecules [BR:mmu04090]
    19261 (Sirpa)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   19261 (Sirpa)
CD molecules [BR:mmu04090]
 Proteins
  19261 (Sirpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 V-set C2-set_2 ig Ig_2 I-set SIT Rax2
Motif
Other DBs
NCBI-GeneID: 19261
NCBI-ProteinID: NP_001277948
MGI: 108563
Ensembl: ENSMUSG00000037902
Vega: OTTMUSG00000015506
UniProt: P97797
Position
2 F1; 2 63.19 cM
AA seq 513 aa AA seqDB search
MEPAGPAPGRLGPLLLCLLLSASCFCTGATGKELKVTQPEKSVSVAAGDSTVLNCTLTSL
LPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYY
CVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRN
ITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSP
LRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTP
KNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSM
QTFPDNNATHNWNVFIGVGVACALLVVLLMAALYLLRIKQKKAKGSTSSTRLHEPEKNAR
EITQVQSLIQDTNDINDITYADLNLPKEKKPAPRAPEPNNHTEYASIETGKVPRPEDTLT
YADLDMVHLSRAQPAPKPEPSFSEYASVQVQRK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccggcccggcccctggccgcctagggccgctgctgctctgcctgctgctc
tccgcgtcctgtttctgtacaggagccacggggaaggaactgaaggtgactcagcctgag
aaatcagtgtctgttgctgctggggattcgaccgttctgaactgcactttgacctccttg
ttgccggtgggacccattaggtggtacagaggagtagggccaagccggctgttgatctac
agtttcgcaggagaatacgttcctcgaattagaaatgtttcagatactactaagagaaac
aatatggacttttccatccgtatcagtaatgtcaccccagcagatgctggcatctactac
tgtgtgaagttccagaaaggatcatcagagcctgacacagaaatacaatctggaggggga
acagaggtctatgtactcgccaaaccttctccaccggaggtatccggcccagcagacagg
ggcatacctgaccagaaagtgaacttcacctgcaagtctcatggcttctctccccggaat
atcaccctgaagtggttcaaagatgggcaagaactccaccccttggagaccaccgtgaac
cctagtggaaagaatgtctcctacaacatctccagcacagtcagggtggtactaaactcc
atggatgttaattctaaggtcatctgcgaggtagcccacatcaccttggatagaagccct
cttcgtgggattgctaacctgtctaacttcatccgagtttcacccaccgtgaaggtcacc
caacagtccccgacgtcaatgaaccaggtgaacctcacctgccgggctgagaggttctac
cccgaggatctccagctgatctggctggagaatggaaacgtatcacggaatgacacgccc
aagaatctcacaaagaacacggatgggacctataattacacaagcttgttcctggtgaac
tcatctgctcatagagaggacgtggtgttcacgtgccaggtgaagcacgaccaacagcca
gcgatcacccgaaaccataccgtgctgggatttgcccactcgagtgatcaagggagcatg
caaaccttccctgataataatgctacccacaactggaatgtcttcatcggtgtgggcgtg
gcgtgtgctttgctcgtagtcctgctgatggctgctctctacctcctccggatcaaacag
aagaaagccaaggggtcaacatcttccacacggttgcacgagcccgagaagaacgccagg
gaaataacccaggtacagtctttgatccaggacacaaatgacatcaacgacatcacatac
gcagacctgaatctgcccaaagagaagaagcccgcaccccgggcccctgagcctaacaac
cacacagaatatgcaagcattgagacaggcaaagtgcctaggccagaggataccctcacc
tatgctgacctggacatggtccacctcagccgggcacagccagcccccaagcctgagcca
tctttctcagagtatgctagtgtccaggtccagaggaagtga

DBGET integrated database retrieval system