KEGG   Mus musculus (mouse): 19264Help
Entry
19264             CDS       T01002                                 

Gene name
Ptprc, B220, CD45R, Cd45, L-CA, Ly-5, Lyt-4, T200, loc
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, C
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04660  T cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    19264 (Ptprc)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    19264 (Ptprc)
   04666 Fc gamma R-mediated phagocytosis
    19264 (Ptprc)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    19264 (Ptprc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19264 (Ptprc)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19264 (Ptprc)
CD molecules [BR:mmu04090]
 Proteins
  19264 (Ptprc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase CD45 fn3 PTP_N Y_phosphatase3 PTPlike_phytase DSPc Myotub-related DUF2207 GnsAB_toxin SCIMP Phage_Gp23
Motif
Other DBs
NCBI-GeneID: 19264
NCBI-ProteinID: NP_001104786
MGI: 97810
Ensembl: ENSMUSG00000026395
Vega: OTTMUSG00000043098
UniProt: P06800 Q8C6Q7
Position
1 E4; 1 60.73 cM
AA seq 1293 aa AA seqDB search
MTMGLWLKLLAFGFALLDTEVFVTGQTPTPSDELSTTENALLLPQSDPLPARTTESTPPS
ISERGNGSSETTYHPGVLSTLLPHLSPQPDSQTPSAGGADTQTFSSQADNPTLTPAPGGG
TDPPGVPGERTVPGTIPADTAFPVDTPSLARNSSAASPTHTSNVSTTDISSGASLTTLTP
STLGLASTDPPSTTIATTTKQTCAAMFGNITVNYTYESSNQTFKADLKDVQNAKCGNEDC
ENVLNNLEECSQIKNISVSNDSCAPATTIDLYVPPGTDKFSLHDCTPKEKANTSICLEWK
TKNLDFRKCNSDNISYVLHCEPENNTKCIRRNTFIPERCQLDNLRAQTNYTCVAEILYRG
VKLVKNVINVQTDLGIPETPKPSCGDPAARKTLVSWPEPVSKPESASKPHGYVLCYKNNS
EKCKSLPNNVTSFEVESLKPYKYYEVSLLAYVNGKIQRNGTAEKCNFHTKADRPDKVNGM
KTSRPTDNSINVTCGPPYETNGPKTFYILVVRSGGSFVTKYNKTNCQFYVDNLYYSTDYE
FLVSFHNGVYEGDSVIRNESTNFNAKALIIFLVFLIIVTSIALLVVLYKIYDLRKKRSSN
LDEQQELVERDDEKQLMDVEPIHSDILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKD
ARKPHNQNKNRYVDILPYDYNRVELSEINGDAGSTYINASYIDGFKEPRKYIAAQGPRDE
TVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFKDIVVTINDHKRCPD
YIIQKLNVAHKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVV
HCSAGVGRTGTYIGIDAMLEGLEAEGKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVE
YNQFGETEVNLSELHSCLHNMKKRDPPSDPSPLEAEYQRLPSYRSWRTQHIGNQEENKKK
NRNSNVVPYDFNRVPLKHELEMSKESEPESDESSDDDSDSEETSKYINASFVMSYWKPEM
MIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELVNGDQEVCAQYWGEGKQTYGDMEVEMK
DTNRASAYTLRTFELRHSKRKEPRTVYQYQCTTWKGEELPAEPKDLVSMIQDLKQKLPKA
SPEGMKYHKHASILVHCRDGSQQTGLFCALFNLLESAETEDVVDVFQVVKSLRKARPGVV
CSYEQYQFLYDIIASIYPAQNGQVKKTNSQDKIEFHNEVDGGKQDANCVRPDGPLNKAQE
DSRGVGTPEPTNSAEEPEHAANGSASPAPTQSS
NT seq 3882 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgggtttgtggctcaaacttctggcctttggatttgcccttctggacacagaa
gtctttgtcacagggcaaacacctacacccagtgatgaactgagcacaacagagaatgcc
cttcttctgcctcaaagtgaccccttacctgctcgcaccactgaatccacacccccaagc
atctctgaaagaggaaatggctcttcagagaccacatatcatccaggtgtgttatccacg
ctgctgcctcacctgtccccacagcctgactcgcagacgccctctgccggaggagctgac
actcagacattcagcagccaagctgacaatcccacactcacgcctgctcccggcggcggg
actgacccaccaggtgtgccaggggagaggactgtaccggggaccattcctgcagacaca
gcctttcctgttgatacccccagccttgcacgcaacagctctgctgcctcacctacacac
acctccaatgtcagcaccacagatatctcttcaggtgccagcctcacaactcttacacca
tccactctgggccttgcaagcactgaccctccaagcacaaccatagctaccacaacgaag
caaacatgtgctgccatgtttgggaacattactgtgaattacacctatgaatctagtaat
cagacttttaaggcagacctcaaagatgtccaaaatgctaagtgtggaaatgaggattgt
gaaaacgtgttaaataatctagaagaatgctcacagataaaaaacatcagtgtgtctaat
gactcatgtgctccagctacaactatagatttatatgtaccaccagggactgacaagttt
tcgctacatgactgcacaccaaaagaaaaggctaatacttcaatttgtttggagtggaaa
acaaaaaaccttgatttcagaaaatgcaacagtgacaatatttcatatgtactccactgt
gagccagaaaataatacaaaatgcattagaagaaatacattcatacctgaaagatgtcag
ttggacaaccttcgtgcccaaacaaattacacatgtgtagcagaaatcttatatcgcggt
gtaaaactcgtcaaaaatgttataaatgtgcagacagatttggggattccagaaacgcct
aagcctagttgtggggatccagctgcaagaaaaacgttagtctcttggcctgagcctgta
tctaaacctgagtctgcatctaaaccccatggatatgttttatgctataagaacaattca
gaaaaatgtaaaagtttgcctaataatgtgaccagttttgaggtggaaagcttgaaacct
tataaatactatgaagtgtccctacttgcctatgtcaatgggaagattcaaagaaatggg
actgctgagaagtgcaattttcacacaaaagcagatcgtccggacaaggtcaatggaatg
aaaacctcccggccgacagacaatagtataaatgttacatgtggtcctccttatgaaact
aatggccctaaaaccttttacattttggtagtcagaagtggaggttcttttgttacaaaa
tacaacaagacaaactgtcagttttatgtagataatctctactattcaactgactatgag
tttctggtctcttttcacaatggagtgtacgagggagattcagttataagaaatgagtca
acaaattttaatgctaaagcactgattatattcctggtgtttctgattattgtgacatca
atagccttgcttgttgttttgtataaaatctatgatctgcgcaagaaaagatccagcaat
ttagatgaacaacaggaactcgttgaaagggatgatgaaaagcagctgatggatgtggag
ccaatccattctgacattttgttggaaacatacaaaaggaagattgctgatgagggcaga
ctgttcctggctgaatttcagagcattccacgggtattcagcaagtttcccatcaaagat
gcccgaaagccccacaatcagaataaaaaccgttatgttgacattcttccctatgattat
aaccgtgtggaactctctgaaataaatggagatgcagggtccacctacataaatgccagc
tacattgatggcttcaaggaacccaggaaatacattgctgcacaagggccccgggatgag
acagttgatgacttctggaggatgatctgggagcaaaaggccacagttattgtcatggtc
acacgatgtgaagaaggaaacaggaacaagtgcgcagaatactggccaagcatggaggaa
ggcactcgggctttcaaagatattgttgtgacaatcaatgaccacaaacgatgtcctgat
tacatcattcagaagctgaacgttgcacataaaaaagaaaaagcaactggaagagaagtg
actcatatccaattcaccagctggccagaccatggggttcctgaagaccctcacctgctc
ctcaaacttcgacggagagttaatgcttttagcaacttcttcagtggtcccattgtggtg
cactgcagtgctggtgttgggcgtacaggtacctacattggaattgatgccatgctggaa
ggcctggaagcagagggcaaagtggatgtctatggttatgttgtcaagctaaggcgacag
aggtgtctgatggtgcaagtggaggcacagtatatcctgattcatcaggctttagtggaa
tacaatcagtttggagaaacagaagtgaacttgtctgagttacattcatgcctacacaac
atgaagaagagagatccacccagtgacccctcccctctggaggctgaataccagagactt
ccttcatacaggagttggaggacacagcacattggaaatcaagaagaaaataagaagaag
aacaggaattctaatgttgttccatatgactttaacagagtgccacttaagcatgaactg
gagatgagcaaagagagtgagcctgaatcagatgagtcttcagatgatgacagtgactca
gaagaaaccagcaaatacattaatgcatcctttgtgatgagttactggaaaccagaaatg
atgattgctgctcaggggccactaaaagaaacgatcggtgacttttggcagatgatattc
caaagaaaagtcaaagttattgtgatgttgacagagttagtgaatggagaccaggaagtc
tgtgctcagtactggggcgaaggaaagcagacttatggagacatggaagtggagatgaaa
gacacaaacagagcctcagcctacactctccgaacttttgagctgagacattccaagagg
aaggagcccagaactgtgtaccagtaccagtgtaccacatggaaaggggaagagctgcct
gcagaacccaaagacctggtgtctatgattcaggacctcaaacagaagcttcccaaggct
tccccagaagggatgaagtatcacaagcatgcatccatcctcgtccactgcagagatgga
tcccagcagacagggttgttctgtgccttgttcaatctcttggaaagtgcagaaacagaa
gatgtggttgatgttttccaagtggtaaagtctctacgcaaagcacggcctggggtggtg
tgcagctatgagcaataccagttcctctatgacatcatcgccagcatctatcccgcccag
aatggacaagtcaagaaaacaaacagccaagacaaaattgaatttcataatgaagtggat
ggaggcaagcaggatgctaactgtgtccgtccagatggtcctctgaataaagcccaggaa
gacagcagaggggtgggaaccccggagcctaccaatagtgctgaggaaccagaacatgct
gccaatggttctgcgagcccagctccaacccagagttcatag

DBGET integrated database retrieval system