KEGG   Mus musculus (house mouse): 192653
Entry
192653            CDS       T01002                                 
Symbol
Ttc36
Name
(RefSeq) tetratricopeptide repeat domain 36
  KO
K24941  tetratricopeptide repeat protein 36
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    192653 (Ttc36)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Other cilium assembly proteins
   192653 (Ttc36)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_12 TPR_16 TPR_8 TPR_9 TPR_10 TPR_14 HemY_N TPR_17 TPR_19
Other DBs
NCBI-GeneID: 192653
NCBI-ProteinID: NP_620401
MGI: 2384760
Ensembl: ENSMUSG00000039438
Position
9:complement(44710697..44714248)
AA seq 186 aa
MGTPNDQAVLQAIFNPDTPFGDVVGLDLEEAEEGDEDGVFPQAQLEHSKALELQGVRAAE
AGDLHTALEKFGQAISLLPDRASAYNNRAQARRLQGDVAGALEDLERAVTLSGGRGRAAR
QSFVQSGLLARFQGRDDDARRDFEKAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLR
APSNGR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggggactccaaatgatcaggcagtgttgcaggccatcttcaaccctgatacccccttt
ggagatgttgttggattggacctggaagaagcagaggagggagatgaagatggagttttc
cctcaagcacagttggagcactccaaggccctggagttgcagggagtgagggcggcagaa
gctggagacctccacacagcactggagaagtttggccaagccattagcctgctacctgac
agagcctctgcctacaacaaccgagcccaagcccggcggctccagggggatgtagcaggc
gccctggaggacttggagcgcgcggtgacattgagcggcggccggggtcgcgccgcccgc
cagagcttcgtgcagagcgggctactggcgagatttcagggccgggacgacgacgcccgc
agggacttcgagaaggctgcgcgactgggcagcccgttcgcacggcgccagctagtgctg
ctcaacccgtacgccgcgctgtgcaaccgcatgctggccgacatgatggggcagctgcgc
gcgcccagcaacgggcgctga

DBGET integrated database retrieval system