KEGG   Mus musculus (house mouse): 192654
Entry
192654            CDS       T01002                                 
Symbol
Pla2g15, ACS, LLPL, Lpla2, Lypla3
Name
(RefSeq) phospholipase A2, group XV
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    192654 (Pla2g15)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    192654 (Pla2g15)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     192654 (Pla2g15)
SSDB
Motif
Pfam: LCAT Abhydrolase_6 Hydrolase_4 DUF676 Abhydrolase_1 FGase
Other DBs
NCBI-GeneID: 192654
NCBI-ProteinID: NP_598553
MGI: 2178076
Ensembl: ENSMUSG00000031903
UniProt: Q8VEB4
Position
8:106876986..106891350
AA seq 412 aa
MDRHLCTCRETQLRSGLLLPLFLLMMLADLTLPAQRHPPVVLVPGDLGNQLEAKLDKPKV
VHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGE
TFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFR
DIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGD
GTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggatcgccatctctgcacctgtcgcgagacccagctccggagtggcctcctgttacct
ctgtttctactaatgatgctggcagacctgacgctcccggcccaacgtcaccccccggtg
gtgctggtgcctggtgatttgggtaaccagttggaagcaaagctggataagccaaaggtt
gtacactacctttgctccaagaagacggacagctacttcacactctggctgaatctggaa
ctgcttctgcctgttatcattgactgctggattgacaatatcaggctggtttacaacaga
acatctcgggccacccagtttcccgatggtgtggacgtgcgtgtccctggctttggggaa
acattttctatggaattcctagaccccagcaagaggaatgtgggttcctatttctacact
atggtggagagccttgtgggctggggctacacacggggtgaagacgttcgaggtgctccc
tatgattggcggcgagccccaaatgaaaacgggccctacttcttggccctgcgagagatg
atcgaggagatgtaccagatgtatgggggccccgtggtgctggtcgcccacagcatgggc
aacgtgtacatgctctactttctgcagcggcagccacaagtctggaaggacaaatatatc
catgccttcgtctcactgggggcgccctgggggggcgtggccaagacgctgcgtgtcctg
gcctcaggagacaacaatcgcattcccgtcattgggccactgaagatccgggaacagcag
cgatctgccgtctctaccagctggctactgccatacaaccacacttggtcacatgaaaag
gtatttgtatacacacccacgactaactacacgctccgggactatcaccggttcttccgg
gacatcggtttcgaagatggctggttcatgcggcaggacacagaagggctggttgaagcc
atgacgccacccggggtggagctgcactgcttgtatggcactggtgttcccacgccaaac
tctttctactacgagagctttcctgatcgggaccccaaaatctgcttcggcgatggtgac
ggcacggtgaacctggagagcgtcctgcagtgccaagcctggcagagccgccaagagcac
agagtatcattgcaggagctgccgggaagcgagcacattgagatgctagccaatgccacc
accttggcttatctgaaacgtgtgcttctggaaccttga

DBGET integrated database retrieval system