KEGG   Mus musculus (house mouse): 192657
Entry
192657            CDS       T01002                                 
Symbol
Ell2
Name
(RefSeq) elongation factor for RNA polymerase II 2
  KO
K15183  RNA polymerase II elongation factor ELL
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03250  Viral life cycle - HIV-1
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    192657 (Ell2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    192657 (Ell2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    192657 (Ell2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     192657 (Ell2)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     192657 (Ell2)
SSDB
Motif
Pfam: ELL Occludin_ELL
Other DBs
NCBI-GeneID: 192657
NCBI-ProteinID: NP_620403
MGI: 2183438
Ensembl: ENSMUSG00000001542
UniProt: Q3UKU1
Position
13:75855603..75920480
AA seq 639 aa
MAAGGAAGLREEQRYGLACGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQF
QGLQGLMKIPKNDPFNEVQNFNFYLSNVGRDNPQGSFDCIQQTLSSSGASQLNCLGFIQD
KITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAISDTVPER
KRSTPMNPANTIRKMHSGNSVSQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNS
LGAILQQVANLNPKDLSYTLKDYVFKELQRDWPGYSETDRQTLDLVLSRKLNPSQNASTS
RSESPLCSSKDAASSPQKRPLDSDFIDPLMNKKARISHLTNRVPPTLNGYLNPTSEKSCA
GLLPPPAAAAIPTLSPLPSTHLPVSNPPQTVNSNSNSPSTPEGLGTQDLPVDSFSQNGSI
FEDQQEKYTSRTCLETLPPSSALLKCPKPMEEEHPVSHKKSKKKSKKHKEKDQIKKLDIE
TMEEKEEDLQREETAKLSNASPNPNEGVKEGCTASMEPSSALELPDYLIKYIAIVSYEQR
QNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIK
QSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWH
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcggcggggggggctgcgggactgcgggaggagcagcggtacgggctggcgtgcggg
cggctggggcaggacaacatcaccgtgctgcatgtgaagctcaccgagacggcgatccgg
gcgctggagacttaccagagccacaagaatttaattccttttagaccttcaattcagttc
caaggactccaagggcttatgaaaattcccaaaaatgatcccttcaatgaagtccagaac
tttaacttctacttgtcaaacgtgggaagagataatcctcagggcagctttgactgcatc
cagcaaacactctctagctctggagcctcccagctcaattgcctgggatttatacaagat
aaaattacagtgtgtgcaacaaatgattcctatcagatgacgcgagaaagaatgacccag
gcagaggaggaatcccgtaatcgaagcacaaaagttatcaaacccggtggaccatatgta
gggaaaagagtgcaaattcgtaaagctcctcaagccatctcggacacagtgcctgagagg
aaaaggtcaacgcccatgaaccctgcaaatacaattcgaaagatgcatagtggcaacagt
gtctctcagaggccatacagggacagggtcatccatttactggcactaaaagcctacaag
aaacctgagctgcttgctcgactgcagaaagatggtgtcaatcaaaaagacaagaactcc
ttgggagcaattctgcaacaggtggccaatctgaatcctaaggacctctcctatacttta
aaggattatgtatttaaggagctccagcgagactggccaggttacagtgagacagacaga
cagacattggatttggtgctctctagaaaactaaatccatctcagaatgctagcaccagc
cggtcagagtctcccctgtgttccagcaaagacgctgcctcatctcctcagaaacgacct
ttggattcagatttcattgatcctttaatgaacaaaaaagctcgaatatctcacctaaca
aacagagtcccaccgacattaaatggttatttgaatcccaccagtgaaaaatcttgtgca
ggcctcctaccaccccctgcagctgctgccatccccaccctctcgccgctgccttcaacc
cacctgcctgtctccaatcctcctcagactgtaaattccaactccaattcccctagcact
ccagaaggcctggggactcaagacctgcctgttgacagttttagtcaaaatggtagcatc
tttgaggaccagcaagaaaaatatacctcaaggacttgtctggaaacattaccccccagc
tcagctctgctaaagtgtccaaagcccatggaagaagagcatccagtgtctcacaaaaag
tccaaaaagaagtctaaaaaacacaaggaaaaggaccaaataaagaaacttgacattgag
accatggaggagaaggaggaagaccttcagagagaagaaactgccaagctgagtaatgcc
agtccaaatcccaatgaaggagttaaagaagggtgcacagcctccatggagccttcttca
gcacttgaactcccagattatttgataaaatatattgctattgtctcttatgagcaacgc
cagaattacaaggatgacttcaatgctgagtatgatgaatacagagctttgcatgcaagg
atggagactgtagccaggagatttattaaactggatgcacaacgaaaacgcctttctccg
ggttcaaaagagtaccagaatgttcatgaagaagtcttacaggaatatcagaagatcaag
cagtccagtcccaattaccatgaagaaaaatacagatgtgaatatcttcataacaagctg
gctcacatcaaaagactaataggtgaatttgaccaacagcaagcagagtcatggcactaa

DBGET integrated database retrieval system