KEGG   Mus musculus (mouse): 192663
Entry
192663            CDS       T01002                                 

Symbol
Abcg4, 6430517O04Rik
Name
(RefSeq) ATP binding cassette subfamily G member 4
  KO
K05680  ATP-binding cassette, subfamily G (WHITE), member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    192663 (Abcg4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    192663 (Abcg4)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG1, 4 subgroups
    192663 (Abcg4)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_7 AAA_21 SMC_N RsgA_GTPase AAA_13 MeaB MMR_HSR1 Rad17 ABC2_membrane_3 AAA_29 AAA_18 PRK Dynamin_N AAA_23
Other DBs
NCBI-GeneID: 192663
NCBI-ProteinID: NP_620405
MGI: 1890594
Ensembl: ENSMUSG00000032131
Vega: OTTMUSG00000029282
UniProt: Q91WA9
Position
9:complement(44184485..44199953)
AA seq 646 aa
MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVD
IEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRE
SGMKGQILVNGRPRELRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKEL
VTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVV
SLMKSLAHGGRTVICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCP
TYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCTMAEKKSSPGKNELPAHCPTCPPELDP
IESHTFATSTLTQFCILFRRTFLSILRDTVLTHLRFMSHVLIGVLIGLLYLHIGDDASKV
FNNTGFLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYTLKAYYLAKTMADVPFQV
VCPVVYCSIVYWMTGQPAETSRFLLFSALAIATALVAQSLGLLIGAASTSLQVATFVGPV
TAIPVLLFSGFFVSFKTIPTYLQWSSYLSYVRYGFEGLILTIYGMERGHLTCLDEQCPFR
DPQIILRELDVEEAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggcggagaaggcattggaggccgtgggctgtggactgggccctggggctgtggccatg
gctgtgacactggaggacggggcagagccccctgtgctgaccacgcacctaaagaaggtg
gagaaccatatcacagaagcacagcgcttctctcacctgcccaagcgctctgctgtggac
atcgagttcgtggaactgtcctattccgtgcgggaggggccctgctggcgcaaacggggt
tacaagaccctcctcaagtgcctgtctggtaagttctgtcgccgagagctgattggcatc
atgggcccctctggggctggcaagtccacattcatgaacatcttggcagggtacagggag
tcggggatgaaggggcagatcctggttaacgggaggccgcgcgagctgaggaccttccgc
aagatgtcctgctacatcatgcaggatgacatgctactgcctcacctcacagtcctggag
gccatgatggtctctgccaacctgaagctgagtgagaagcaagaggtgaagaaggaactg
gtgacagagatcctgacagccctgggactgatgtcctgctctcacacgaggacagctctg
ctctctggagggcagaggaagcgcctggccattgctctggaactggtcaacaacccgcct
gtcatgttctttgatgagcctaccagcggtctagacagcgcttcttgtttccaagtggtg
tccctcatgaagtccctggcccatgggggccgcaccgtcatctgcaccatccaccagccc
agtgccaagctctttgagatgtttgacaagctctacatcctgagccaggggcaatgcatc
ttcaagggcgtggttaccaacctgattccctatctgaaggggcttggcttgcactgtccc
acctaccacaaccccgctgacttcatcattgaggtggcctctggagagtatggagacctg
aaccccatgctgttcagggctgtgcagaatggcctttgcaccatggccgagaagaagagc
agccctgggaagaatgagctccctgcccactgccccacttgccctccggagctggatcct
attgaaagccacacatttgccaccagcaccctaacccagttctgcatcctcttcaggagg
actttcttgtccatcctcagggacacggtcctgacccacttgcggttcatgtcacatgtg
ttgatcggcgtcctcattggcctcctctacctgcacattggcgatgatgccagcaaagtc
ttcaacaacaccggcttcctcttcttttccatgctcttcctcatgtttgcagccctcatg
ccgaccgtgctcacctttcccttagagatggcggtcttcatgagggagcacttgaactac
tggtatactctcaaagcctattacttggccaagaccatggctgatgtgcccttccaggtg
gtatgcccagtggtgtactgcagcatcgtgtactggatgacaggccagccagccgagacc
agccgcttcctgctcttctcagccttggccatagccaccgccttagttgcccagtctttg
ggactcttgattggcgctgcctctacctccttgcaggtggccacttttgtgggcccagtg
actgccatccctgtcctcttgttctccggcttcttcgtcagtttcaagaccatccccact
tacttgcaatggagctcctacctctcctatgttaggtatggctttgagggtctgatcctg
accatctatggtatggagcgaggacacctgacctgcttagatgaacagtgcccattccgg
gacccacaaatcattttgcgtgagctggatgtagaggaggccaaactctacatggacttc
ctggtcctgggcattttcttccttgccctgcggctgctggcataccttgtgctccggtac
cgggtcaagtctgagagatag

DBGET integrated database retrieval system