KEGG   Mus musculus (house mouse): 19267
Entry
19267             CDS       T01002                                 
Symbol
Ptpre, PTPe, PTPepsilon, RPTPepsilon
Name
(RefSeq) protein tyrosine phosphatase, receptor type, E
  KO
K18033  receptor-type tyrosine-protein phosphatase epsilon [EC:3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19267 (Ptpre)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19267 (Ptpre)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19267 (Ptpre)
SSDB
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase2 DUF4381
Other DBs
NCBI-GeneID: 19267
NCBI-ProteinID: NP_001303608
MGI: 97813
Ensembl: ENSMUSG00000041836
UniProt: P49446
Position
7:135139195..135288023
AA seq 699 aa
MEPFCPLLLASFSLSLARAGQGNDTTPTESNWTSTTAGPPDPGASQPLLTWLLLPLLLLL
FLLAAYFFRFRKQRKAVVSSNDKKMPNGILEEQEQQRVMLLSRSPSGPKKFFPIPVEHLE
EEIRVRSADDCKRFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHCRVILSQV
DGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQRSATIVMLTNLKERKE
EKCYQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIHPQLPDSCKAPRLVSQLHFTSW
PDFGVPFTPIGMLKFLKKVKTLNPSHAGPIVVHCSAGVGRTGTFIVIDAMMDMIHSEQKV
DVFEFVSRIRNQRPQMVQTDVQYTFIYQALLEYYLYGDTELDVSSLERHLQTLHSTATHF
DKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEFTDY
INASFIDGYRQKDYFMATQGPLAHTVEDFWRMVWEWKSHTIVMLTEVQEREQDKCYQYWP
TEGSVTHGDITIEIKSDTLSEAISVRDFLVTFKQPLARQEEQVRMVRQFHFHGWPEVGIP
AEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQA
VKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggagcccttctgtccactcctgctggcaagttttagcttgtcgctcgccagagctggc
cagggcaacgacaccaccccaacagagagcaactggaccagcacaactgcaggccctccg
gaccctggtgcatcccagccgctgctcacctggctgctgctgcccctgctcctcctcctg
ttcctgcttgcagcctacttcttcaggttccggaagcagaggaaggccgtggtcagcagc
aacgacaagaaaatgcctaacgggatcttagaagagcaagagcagcagagagtgatgctg
ctgagcagatctccatcaggccccaagaagttcttccccatccccgtggagcacctggag
gaggagatccgggtgagatctgcggatgactgcaagcgattccgagaggagttcaattca
ttgccatctggacacatacaaggaacctttgaactagcaaataaagaagaaaacagagaa
aaaaacagataccccaacattctgcccaatgatcattgcagagtgattttgagccaagtg
gatggaatcccctgctctgactacattaatgcttcctacatcgatggctacaaagaaaag
aacaaattcatagcagctcaaggccctaagcaggagacagtgaatgacttctggagaatg
gtctgggagcaaaggtcagccaccatcgtcatgttgacgaacctgaaggagaggaaggag
gagaagtgctaccagtactggccagaccagggctgttggacctacggcaacatccgggtg
tgtgtagaggactgcgtggtcctggtggattacacgatccgaaagttctgcatccatccg
caactcccagacagctgcaaagccccgcggctggtctcacagctgcacttcaccagctgg
cctgacttcggggtgccgtttacccccatcgggatgctcaagttcctgaagaaagtgaag
acactcaacccctcacatgctgggcccattgtggttcactgtagcgcgggcgtgggtcgg
actggcaccttcattgtgatcgatgccatgatggacatgatacactcggagcagaaggtt
gacgtctttgagtttgtgtctagaatccgcaatcagcgccctcagatggtccagacggat
gttcagtatacattcatctaccaagccttactggaatactacctctatggggacacagag
ctggatgtgtcctccctggagaggcacctgcagacgctccatagcacagccacccatttt
gacaagatcgggctggaggaagagttcaggaagctgaccaacgtgcgaatcatgaaggag
aacatgaggacgggcaacctgcctgccaacatgaagaaggcccgcgtcatccagatcatt
ccatatgacttcaatcgggtcatcctgtccatgaaaagagggcaagagttcacagactat
atcaacgcatccttcatagatggctacaggcagaaggactacttcatggccacacagggg
cctctggctcacacagttgaggacttctggaggatggtatgggagtggaagtctcacaca
atcgtcatgctgacggaggtgcaggagcgggaacaggataaatgctaccagtattggcca
acggagggctcggtgactcatggagatataactatagagataaagagcgacaccctgtct
gaagcaatcagcgtacgagactttctggttaccttcaaacagcccctggcccgccaggaa
gagcaggtccgcatggtgagacaattccatttccatggctggcctgaggttggcatcccc
gctgaaggcaaaggcatgattgacctgattgcagcagtgcagaagcagcagcagcagacg
ggcaaccaccccatcaccgtgcactgcagcgcgggagcagggcggacaggtacattcata
gcactcagtaacattttggaacgagtgaaagccgagggactcctagacgtgtttcaagct
gtgaagagcttaagacttcagagaccacacatggtgcagaccctggagcaatatgaattc
tgctacaaagtggtacaagattttatcgatatattttctgattatgctaatttcaaatga

DBGET integrated database retrieval system