KEGG   Mus musculus (mouse): 19270
Entry
19270             CDS       T01002                                 

Gene name
Ptprg, 5430405N12Rik, AW046354, AW549872, RPTPgamma
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, G
  KO
K16667  receptor-type tyrosine-protein phosphatase gamma [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19270 (Ptprg)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19270 (Ptprg)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19270 (Ptprg)
SSDB
Motif
Pfam: Y_phosphatase Carb_anhydrase fn3 DSPc Y_phosphatase3 PTPlike_phytase Mitofilin DUF5681
Other DBs
NCBI-GeneID: 19270
NCBI-ProteinID: NP_033007
MGI: 97814
Ensembl: ENSMUSG00000021745
Vega: OTTMUSG00000029429
UniProt: Q05909 F8VQD7
Structure
PDB: 
3JXG 5E5U 3KLD

Position
14 A1; 14 6.33 cM
AA seq 1442 aa
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGTLQESRQDSSVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGSHQSPIDILDHHARVGDEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFILRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQALNDRVVSKSAVRDAWNHDLADFLDNPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
ASAASKQAGRTVLATTEALASPGPDVDSAPTKDSEGTEEGEKEEKSESEDGEREHEEEEK
DSEKKEKSEATHTAAESDRTAPAPTPSSPHRTAAEGGHQTIPGRRQDHSAPATDQPGHVA
PDLDPLVDTATQVPPTATEEHYSGSDPRRPEMPSKKPMSRGDRFSEDSKFITVNPAEKNT
SGMLSRPSPGRMEWIIPLIVVSALTFVCLVLLIAVLVYWRGCNKIKSKGFPRRSREVPSS
GERGEKGSRKCFQTAHFYVEDSSSPRVVPNESVPIIPIPDDMEAIPVKQFGKHIGELYSN
SQHGFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHSRVKLRPLPGKDSKH
SDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQ
YWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHY
TQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDK
STVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPG
VGGKTRLEKQFKLITQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLPGMKGT
DYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYW
PSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPD
APISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVA
KMINLMRPGVFTDIEQYQFVYKAMLSLISTKENGNGPMTGDKNGAVLTAEESDPAESMES
LV
NT seq 4329 nt   +upstreamnt  +downstreamnt
atgcggaggttactggaaccgtgttggtggattttgttcctgaaaatcaccagttctgtg
cttcattatgtggtgtgcttcccggcattgactgaaggctatgtggggaccctgcaggag
agcagacaggacagctcagtgcagatccgcagacgaaaggcatccggagacccatactgg
gcgtattctggtgcctatggtcctgagcactgggtcacatctagtgtcagctgcgggggc
agccatcagtctcctatagacattttagaccaccatgctcgcgttggcgatgaataccag
gagcttcaacttgatgggtttgacaacgagtcctctaacaaaacctggatgaaaaataca
gggaaaacagttgccatcctgctgaaagacgattattttgtgagtggtgccggactgccg
ggcagattcaaagctgagaaggtggagtttcactggggccacagcaatggctccgctggc
tcagagcatagtgtcaatggccggaggtttcctgtggagatgcagattttcttttacaac
ccagacgactttgacagctttcaaacggcaatttctgagaacagaataattggagctatg
gccatatttttccaagtcagtccgagggacaattctgcactggatcctattatccacggg
ctgaagggcgtcgtacatcacgagaaggagactttcctggatcctttcattctccgagac
ctcctgcccgcatccctggggagttattacaggtacacaggctccttgactacgccaccc
tgtagtgaaatagtggagtggattgtcttccggaggcccgttcccatctcctatcaccag
cttgaggctttttattctatcttcaccacggagcagcaagaccatgtcaagtcagtggag
tacctgagaaataacttccgaccacaacaagctctgaatgacagagtggtgtcaaagtct
gctgtccgggatgcctggaaccatgacctggcagacttcttggacaacccactaggcaca
gaagcctctaaagtttgcagctctccgcccatccacatgaaggtgcagcctctgaaccag
acagctctgcaggtgtcctggagccaacctgaaaccatctaccacccgcccatcatgaat
tacatgatctcctatagctggaccaagaatgaggacgagaaggagaagacatttacaaaa
gacagtgacaaggacttgaaagccaccatcagccatgtctcacccgatagcctttaccta
ttccgagtacaggctgtgtgtaggaatgacatgcggagtgacttcagccagacaatgctc
tttcaagctaatactacccggatcttccaagggaccaggattgtgaaaacaggagtgccg
acagcctctcctgcctcttcagcagacatggcccccatcagctctggctcttccacttgg
acatcctccggcatccccttctcatttgtttccatggcaactgggatgggcccttcctcc
agtggcagccaagctacagtggcctctgtggtcaccagcacactgttggcaggcctgggc
ttcggtggtggtggcatctcctccttccccagtaccgtgtggcccacgcgccttcccacc
gcatctgcagccagcaagcaggcagggaggacagttcttgccaccaccgaggccttagct
tcccctgggccggatgtcgactcggcaccgacgaaggacagcgagggtacagaggaggga
gagaaggaggagaaaagcgagagcgaggatggtgagcgagagcatgaggaggaagagaag
gactctgagaagaaggagaagagtgaggctactcacacagccgcagagagtgaccggact
gcacctgcccccaccccctcttcccctcataggactgcagcggagggaggacatcagact
atacctgggcgcaggcaggaccactctgcccctgccacagaccagccgggccacgttgcc
ccagacttggatccccttgtggacacagccacccaagtgcccccaacagccacagaggaa
cattattcagggagtgatcccaggaggcccgaaatgccatctaaaaagcctatgtcccga
ggggaccgattttctgaggatagcaaattcatcacagttaacccagctgagaagaacacc
tctggcatgctaagccgcccctcccccgggaggatggagtggatcatccccctgattgtg
gtctcagccttgaccttcgtgtgcctcgtcctcctcattgccgtgctggtgtactggaga
gggtgtaacaaaataaagtccaagggctttccccgacgttcccgtgaagtgccttcttct
ggggagagaggagagaaggggagcagaaaatgttttcagactgctcatttctatgtggaa
gacagcagttcacctcgggtggtccccaacgaaagtgttcctattattcccatcccggat
gacatggaagccattcctgtcaaacagtttggtaaacacatcggtgagctctattccaat
agccagcatggcttctcggaagattttgaggaagtccagcgctgtacagctgatatgaac
atcactgcagagcattccaatcatccggataacaagcacaaaaacagatacatcaacatt
ttagcatatgatcacagtagggtgaagttaagacctttaccaggaaaggactctaagcac
agcgactacattaatgcaaactatgtcgatggttacaacaaagcgaaagcctacattgcc
acccagggacctttaaaatccacctttgaagacttctggaggatgatctgggaacaaaac
acgggaatcatcatcatgatcacgaacctcgtggagaaaggaaggagaaagtgtgatcag
tattggccaacggagaacactgaggagtacgggaacattattgtcacactgaagagcaca
aaagtacatgcctgctacaccgtccgtcgtctttcagttagaaacacaaaagtgaaaaag
ggccagaagggcaaccccaaaggtcgtcagaatgagcggacggtgatccagtaccactac
acacagtggcctgacatgggtgtccctgagtacgccctcccagtcctgaccttcgtgagg
aggtcatctgcggcccgcatgccagacatggggcccgtgttggtgcactgcagcgctggt
gtgggcaggacaggcacctacattgtaatagacagcatgctgcagcagatcaaagacaaa
agcacagttaatgtcctgggcttcctgaagcatatcaggacacagaggaactacctcgtc
cagactgaggagcagtacattttcatccatgatgccttgttggaagccattctcgggaag
gaaactgaagtatcttcaagtcagctgcatagctatgttaacagcatcctcataccagga
gtaggaggaaagacacggctggaaaagcagtttaagctgatcacgcagtgtaatgcaaag
tatgtggagtgcttcagtgcccagaaggagtgcaacaaagagaagaacaggaactcgtct
gttgtgccagctgagcgtgctcgagtgggacttgcaccgttgcccgggatgaaaggaaca
gattacattaatgcttcttacatcatggggtattatagaagcaacgagttcatcataacc
cagcatcctctgccacacactacgaaagatttctggagaatgatttgggatcataatgca
cagatcattgtcatgctgccagacaaccagagcctggcagaagatgagtttgtgtactgg
ccgagtcgtgaggaatccatgaactgtgaggcctttactgtcaccctcatcagcaaagac
aggctatgcctctcgaatgaagaacaaattatcatccatgacttcatccttgaagctaca
caggatgactacgtactagaggttcggcactttcagtgtcccaaatggcctaacccagat
gcccctataagtagtaccttcgaactgatcaatgtcatcaaggaagaggccttaacccgg
gatggccccaccattgttcatgatgagtatggagcagtttctgcaggaatgttgtgtgcc
cttaccaccttgtcccagcagctagagaatgaaaatgctgtggatgtgttccaggtggca
aaaatgatcaatcttatgagacctggagtattcacagacattgaacaataccagtttgtc
tacaaagcaatgctcagcttgatcagtactaaagaaaatggaaatggtcccatgaccggg
gacaaaaacggtgctgtgctaactgcagaggaatcagaccctgcagagagcatggagtct
ctggtgtga

DBGET integrated database retrieval system