KEGG   Mus musculus (mouse): 19279
Entry
19279             CDS       T01002                                 

Gene name
Ptprr, Gmcp1, PT, PTP, PTP-SL, PTPBR7, R, RPTPRR, mPTP213
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, R
  KO
K04458  receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19279 (Ptprr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19279 (Ptprr)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19279 (Ptprr)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19279 (Ptprr)
SSDB
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase WBP-1 LST1 DUF1999
Other DBs
NCBI-GeneID: 19279
NCBI-ProteinID: NP_035347
MGI: 109559
Ensembl: ENSMUSG00000020151
Vega: OTTMUSG00000026109
UniProt: Q62132 Q5U1U6 Q8CEI8
Structure
PDB: 
1JLN

Position
10; 10 D2
AA seq 656 aa
MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPVFIYDHSQDIKKSLDIAQEA
YKHNYHSPSEVQISKHHQIINSAFPRPAYDPSLNLLAESDQDLEIENLPIPAANVIVVTL
QMDITKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNQVELFVSPGNRKPGETQALQ
AEEVLRSLNVDGLHQSLPQFGITDVAPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIII
VTCLMIIYRLKERLQLSLRQDKEKNQEIHLSPIARQQAQSEAKTTHSMVQPDQAPKVLNV
VVDPQGQCTPEIRNSTSTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGSVEPFVAVST
PREKVAMEYLQSASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRY
KTILPNPLSRVCLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVW
QEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVTGVTECDNYTIRNLVLKQGSHT
QHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIAT
SIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVE
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgaggagagcggtcggcttccctgcgctgtgcctgcttcttaatcttcatgctgcaggt
tgtttttccagaaacaatgatcactttttggctattcgtcaaaagaagagttggaagccg
gtgttcatttatgaccattcacaggatatcaagaagagcctggacatcgcacaagaggca
tacaaacataactaccactccccttccgaagttcaaataagcaaacatcaccagattatt
aattcagcatttcctagacctgcatatgacccgtctcttaatctgttggctgagtctgat
caagatcttgaaatagaaaatctcccaattccagcagcaaatgtgattgtggtgacactg
caaatggatataaccaagctgaacataaccctgcttcggatcttccgccaaggagtagct
gcagccctgggactcttacctcagcaagtgcacattaaccggctcattgaaaagaagaac
caggttgagttgtttgtgtctcccggaaaccggaaaccaggagaaacgcaggccctgcag
gctgaggaagtgctgcgttccctcaatgtggatggtttgcatcagagtttaccacagttt
ggaattacagacgtcgcccctgagaaaaatgttttacaagggcagcacgaagcagacaag
atctggagcaaagaaggattttacgctgtcgtcatcttcctcagcatctttatcatcata
gtaacctgtttgatgattatttacaggttaaaagaaaggcttcagctttccttaagacaa
gataaagagaaaaaccaggagatccacctatcacccattgcacggcagcaagcacaatcg
gaggccaagacgacccacagcatggtccagcccgatcaggcgccaaaggtgctgaacgtg
gttgtggaccctcaaggccaatgcactcctgagattcgaaacagcacctccacctctgtc
tgcccttctcccttcagaatgaagcccataggactccaggagcgacgaggttccaatgta
tctcttacgctggacatgagtagcctgggcagtgtggaaccctttgtggccgtctcaacc
ccccgggagaaggtagccatggaatacctgcagtcagccagccgagttctcacacggtca
cagctgagggacgtcgtggcaagttcccacctacttcaaagtgaattcatggaaatacca
atgaattttgtggatcccaaagaaattgatattccacgtcacggaactaaaaatcgttat
aagaccattttgccaaatcccctcagcagagtgtgcttaagaccaaaaaatataaccgat
tccttgagtacttacataaatgctaactatattcggggctacagtggtaaggagaaagcc
ttcattgccacccagggccccatgatcaacactgtgaatgacttctggcagatggtgtgg
caagaagacagtcccgtgattgtgatgatcacgaaactcaaagagaaaaatgagaaatgt
gtgctctactggccagaaaagagagggatttacggcaaggttgaggttctggtcaccggt
gtgaccgaatgtgataactacaccatccgcaacctcgtcttaaagcaaggaagtcacacc
caacatgtgaagcactactggtacacttcatggccggatcataagactccagacagtgcc
cagccccttctgcagctcatgttggatgtggaagaagacagactggcctctgaaggccga
gggcctgtggttgtccactgcagtgcggggattgggagaactgggtgtttcatcgctaca
tccattggctgtcaacaattgaaagaagaaggagttgtagacgcactaagtattgtctgc
cagcttcgtgtagacaggggtggtatggtccaaaccagcgagcagtatgaatttgtgcac
catgctctgtgcctgttcgagagcagactttcaccagaaactgtcgagtga

DBGET integrated database retrieval system