KEGG   Mus musculus (mouse): 19280Help
Entry
19280             CDS       T01002                                 

Gene name
Ptprs, AL022616, PTP, PTP-NU3, PTPNU-3, PTPsigma, Ptpt9, R-PTP-S, RPTPsigma
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, S
  KO
K06778  receptor-type tyrosine-protein phosphatase S [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19280 (Ptprs)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19280 (Ptprs)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19280 (Ptprs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Ig_2 Pur_ac_phosph_N ig Interfer-bind DSPc Y_phosphatase3 PTPlike_phytase Ig_5
Motif
Other DBs
NCBI-GeneID: 19280
NCBI-ProteinID: NP_035348
MGI: 97815
Ensembl: ENSMUSG00000013236
Vega: OTTMUSG00000014929
UniProt: B0V2N1 Q3TQ52
Structure
PDB: 

Position
17 D; 17 29.32 cM
AA seq 1907 aa AA seqDB search
MAPTWSPSVVSVVGPVGLFLVLLARGCLAEEPPRFIREPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHA
KLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMS
HEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVA
MSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSYYVIEYKSKSQD
GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNV
QARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLE
DETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESV
IKYELLFREGDRGREVGRTFDPTTAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRT
LQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNN
IPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALN
ATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPE
TAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPADAAEDP
VLGYRLQFGREDAAPATLELAAWERRFAAPAHKGATYVFRLAARGRAGLGEEAAAALSIP
EDAPRGFPQILGAAGNVSAGSVLLRWLPPVPAERNGAIIKYTVSVREAGAPGPATETELA
AAAQPGAETALTLRGLRPETAYELRVRAHTRRGPGPFSPPLRYRLARDPVSPKNFKVKMI
MKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHLKPHTFYNFVLTNRGSS
LGGLQQTVTARTAFNMLSGKPSVAPKPDNDGFIVVYLPDGQSPVTVQNYFIVMVPLRKSR
GGQFPVLLGSPEDMDLEELIQDISRLQRRSLRHSRQLEVPRPYIAARFSILPAVFHPGNQ
KQYGGFDNRGLEPGHRYVLFVLAVLQKNEPTFAASPFSDPFQLDNPDPQPIVDGEEGLIW
VIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRIN
FQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNR
YANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWE
QRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGS
SEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIV
IDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSL
YTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSR
VCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQF
TDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMR
YEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFDHYAT
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacctggagtcccagcgtggtgtctgtggtgggtcctgtggggctcttcctc
gtactgctggccagaggatgcttggctgaagaaccacccaggtttatcagagagcccaag
gatcagattggagtgtcgggaggcgtggcctccttcgtgtgccaggccacgggtgatcct
aagccacgggtgacctggaacaagaagggcaagaaagtgaactcacagcgcttcgagacc
attgactttgacgagagctctggggcggtcctgaggatccagccacttcggacgcctcgg
gatgagaacgtgtacgagtgtgtggcccagaactcggtgggcgaaatcacaattcatgca
aagctcaccgtccttcgagaggaccagctgcctcctggcttccccaacattgacatgggc
ccccagttgaaggttgtagagcgcacacgcacagccaccatgctctgtgctgccagcggg
aacccggaccctgagatcacctggtttaaggacttcctgcctgtggaccccagtgccagc
aacgggcggatcaagcagcttcgatcaggtgccctgcagattgagagcagcgaggagaca
gaccagggcaagtacgagtgtgtggccaccaacagcgctggggtgcgctactcatcacct
gccaacctctacgtgcgagtccgccgtgtggccccacgcttctccatcctgcccatgagc
cacgagatcatgcccggtgggaatgtgaatatcacttgtgtggccgtgggctcacccatg
ccctacgtgaaatggatgcagggggccgaggacctgacgcctgaggatgacatgcccgtg
ggtcggaatgttctagaactcacggatgtcaaggactcagctaactacacttgtgtggcc
atgtccagcctgggtgtgatcgaggccgtggcccagatcactgtaaaatctctccccaaa
gcccctgggactcctgtggtgacggagaacactgccaccagtatcactgtcacatgggac
tcgggcaaccctgaccccgtgtcctactacgtaattgagtataagtccaaaagccaggat
gggccgtatcagatcaaagaagacatcaccaccacgcgctacagcatcggaggcctgagc
cccaattctgagtatgagatctgggtgtcagctgtcaactccattggccagggccctccc
agtgaatcggtggtgacccgcacaggtgagcaggcaccagccagcgctcccaggaatgtt
caggcccgcatgctcagcgccaccaccatgatcgtgcagtgggaggagcctgtggagccc
aatggcctgatccgtggctaccgtgtctactataccatggagccggaacacccagtgggc
aactggcagaaacacaatgtggacgacagtctcctgaccactgtgggcagcctgctggaa
gacgagacctacaccgtgcgcgtgctcgccttcacgtcggtgggcgacggaccactgtca
gaccccatccaggtcaagacccagcagggagttcctggccagcccatgaacttgcgggct
gaggccaagtcagagaccagcattgggctctcgtggagtgcaccacgacaggagagtgtc
attaagtatgaactgctcttccgggagggcgaccgaggccgagaggtggggcgaaccttc
gacccaaccacagcctttgtggtggaggacctcaagcccaatacggagtatgcgttccgg
ctggcggcgcgctcgccgcagggcctgggcgccttcaccgcggtcgtgcgccagcgcacg
ctgcaggccaaaccgtcagccccccctcaagacgttaagtgcaccagcttgcgctccacg
gccatattggtaagttggcgcccgccaccgccagaaactcacaacggggccctcgtgggc
tacagcgtccgctaccgaccgctgggctcagaggacccggaccccaaggaggtgaacaac
atacccccgaccaccactcagatccttctggaagctttggagaaatggacggagtaccgt
gtcaccgccgtggcttacacagaggtgggaccagggcccgagagctcgcccgtggtcgtc
cgcaccgatgaggacgtgcccagcgcgcccccgcggaaggtggaggcggaggcgctcaac
gccacagccatccgagtgctgtggcgctcgcccacgcccggccggcagcacgggcagatc
cgcggctaccaggtccactatgtgcgcatggagggtgccgaggcccgcgggccaccgcgc
atcaaggacatcatgctggcggatgcccaggaaatggtgataacgaacctccagcctgag
actgcttactctatcacagtagccgcgtataccatgaaaggcgatggcgctcgcagcaaa
ccgaaggtggtggtgaccaagggagcagtgctgggccgccccaccctgtcggtgcagcag
acccccgagggcagcctgctggcgcgctgggagccccccgcggacgcggccgaggacccg
gtgcttggctaccgcctgcagtttgggcgcgaagacgcggccccggccacgttggagctg
gctgcgtgggagcggcggttcgcggcgcctgcacacaagggcgccacctatgtgttccgg
ctggcagcgcggggccgcgcggggttgggcgaggaggccgcggcagcgctgagcatcccc
gaggacgctccgcgcggcttcccgcagatcttgggcgccgcgggcaacgtgtccgcgggc
tccgtgctactgcgctggctgccacccgtgcccgccgagcgcaacggcgccatcatcaag
tacacggtgtccgtgcgggaggccggcgcccctgggcccgcgaccgagacggagctggcg
gcggccgcccagccgggggccgagacagcgctcacgctgcgagggctgcggccggagacg
gcctacgagttacgcgtgcgcgcacacacgcgtcgcggcccgggccccttctcacccccg
ctgcgctacaggctcgcgcgggacccagtctccccaaagaacttcaaggtgaagatgatc
atgaagacttcagtgctgctgagctgggagttccccgacaactataactcacccacaccc
tacaagattcagtacaatgggctcaccctggatgtggacggccgcacgaccaagaagctg
atcacacacctcaagccacacaccttctataatttcgtgctcaccaaccgtggcagcagc
ctggggggcctgcagcagacggtcactgccaggaccgcctttaacatgctcagtggcaag
cctagcgtcgccccgaagcccgacaatgacggtttcatcgtggtctacctgcctgatggc
cagagtcctgtgaccgtgcagaactacttcattgtgatggtcccacttcggaagtctcga
ggtggccagttccctgtcctactaggtagtccagaggacatggatctggaggagctcatc
caggacatctcccggctgcagaggcgcagcctgcgccactccagacagctggaggtgcct
cggccctacatcgccgctcgattctccatcctgccagctgtcttccatcctgggaaccag
aagcaatatggtggctttgacaacaggggcttggagccaggccaccgctatgtcctcttt
gtgcttgctgtgttgcagaagaatgagcctacatttgcagccagtcccttctcagacccc
ttccagctggacaacccggaccctcagcccattgtggacggcgaggagggcctcatctgg
gtgattgggcctgtgctggccgtggtcttcatcatctgcatcgtgattgccatcctgctg
tacaagaacaaacctgacagcaaacgcaaggactcagagccccgcaccaaatgcttactg
aacaatgccgaccttgccccccatcaccccaaggaccctgtggaaatgcgacgcatcaac
ttccagacaccaggtatgctcagccacccacccatccccatcacagacatggcggagcac
atggagagactcaaagccaacgacagcctgaagctctcccaggagtacgagtccattgac
cccgggcagcaattcacgtgggaacattcgaacctggaggccaacaagcccaagaaccgc
tatgccaacgtcatcgcctatgaccactcacgagtcatcctgcagcccctagaaggcatc
atgggtagtgattacatcaatgccaactatgtggacggctaccggcggcagaatgcatac
attgccacgcaggggcccctgcctgagacctttggggacttctggcggatggtgtgggag
cagcgatcggccactgtggtcatgatgacgcgactggaggagaaatcacggatcaaatgt
gaccaatactggcctaaccgaggcaccgagacatacggcttcatccaggtcaccctacta
gataccatggagctggctaccttctgcgtcaggactttttctctacacaagaatggctct
agcgagaagcgtgaggtgcgacatttccagttcacggcatggcccgaccacggggtacct
gagtaccccacgcccttcctggcattcctgcgaagagtcaagacctgcaacccgcctgat
gctggccccattgtggtccactgcagcgcgggtgtggggcgcactggctgcttcatcgta
attgacgccatgctagagcgcatcaagacagagaagaccgtggatgtgtatggacatgtg
acactcatgcggtcgcagcgcaactacatggtgcagacagaggatcagtatggcttcatc
cacgaggcgctgctggaggctgtgggctgcggcaataccgaggtccctgctcgcagcctc
tacacctacatccagaagctggcccaggtggagcctggcgagcacgtcacgggcatggag
cttgagttcaagaggctcgccagttccaaggcacacacttcgcgcttcatcaccgccagc
ctgccttgcaacaagtttaagaaccgactggtgaacatcctgccgtacgagagctcgcgt
gtctgcctgcagcccatccgcggtgtggagggctctgactacatcaatgccagctttatc
gacggctatagacagcagaaagcctacattgcaacacaggggccactggcagagaccaca
gaggacttctggcgagctctgtgggagaacaactctactattgtcgtaatgctcaccaag
ctccgagaaatgggccgggaaaagtgccaccagtactggccagccgagcgctctgcccgc
taccagtactttgtggttgacccgatggcagagtataacatgccacagtacattctgcgt
gagtttaaggtcacagatgcccgggatggccagtcccggaccgtccgacagttccagttc
acggactggccagagcagggtgcacccaagtcaggggaaggcttcattgacttcatcggc
caagtgcataagaccaaggagcagtttggccaggacggacccatctcagtgcactgcagc
gccggagtgggcaggaccggagtgttcatcaccctgagcatcgtgcttgagcggatgcgc
tacgagggcgtggtggacattttccagacagtgaaggtgcttcggacccagaggcctgcc
atggtgcagacagaggacgagtaccagttctgcttccaggcggctttggaatacctgggc
agttttgatcattatgcaacataa

DBGET integrated database retrieval system