KEGG   Mus musculus (mouse): 19283Help
Entry
19283             CDS       T01002                                 

Gene name
Ptprz1, AI850339, DSD-1-PG, PTPbeta, PTPzeta, Ptprz, Ptpz, R-PTP-zeta, RPTPz, Rptpbeta
Definition
(RefSeq) protein tyrosine phosphatase, receptor type Z, polypeptide 1
  KO
K08114  receptor-type tyrosine-protein phosphatase zeta [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19283 (Ptprz1)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    19283 (Ptprz1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19283 (Ptprz1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19283 (Ptprz1)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   19283 (Ptprz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Carb_anhydrase fn3 DSPc Y_phosphatase3 Peptidase_C10 PTPlike_phytase Orf78
Motif
Other DBs
NCBI-GeneID: 19283
NCBI-ProteinID: NP_001074775
MGI: 97816
Ensembl: ENSMUSG00000068748
Vega: OTTMUSG00000055926
UniProt: B9EKR1
Position
6; 6 A3.1
AA seq 2312 aa AA seqDB search
MRILQSFLACVQLLCLCRLDWAYGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPICNSPK
QSPINIDEDLTQVNVNLKKLKFQGWEKASLENTFIHNTGKTVEINLTNDYYLSGGLSEKV
FKASKITFHWGKCNVSSEGSEHSLEGQKFPLEMQVYCFDADRFSSFEEAVKGKGRLRALS
ILFEVGVEENLDYKAIIDGTESVSRFGKQAALDPFVLQNLLPNSTDKYYIYNGSLTSPPC
TDTVEWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEVVCSSEPENVQADPENYTSLLVTWERPRVVYDAMIEKFAVLYQPLAGNDQAK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAVCSNGLYGKYSDQLIVDMPTEDAELDLFPE
LIGTEEIIKEEEYGKDNEEDTGLNPGRDSVTNQIRKKEPQVSTTTHYNHMGTKYNEAKTN
RSPTRGSEFSGKSDVPNTSPNSTSQHVAEFETERGISLPSQTGTNLPPHNVEGTSASLNS
GSKTLFIFPQMNLSGTAESLNTVPITEYKEVSADVSEEENFLTDFKLDTGADDSSGSSPS
TSTVPFSSDNLSHGYITSSDMPEAITYDVLKPGSTRNAPEDSAPSGSEESLKDPSLEGSV
WFPGSTDLTTQSETGSGRESFLQVNSTDIQIDESRETTESFSPDATVSQDPSVTDMGMPH
YSTFAYLPTEVTPQAFTPSSRPLDLAPTINILHSQTTQPVYNGETPLQPSYSSEVFPLAT
PLLLDNQTLNTTPAASSSDSALHATPVSPSVGVSFESILSSYDDAPLLPFSSASFSSEMF
RHLHTVSQTLPQVTSAAERDELSLHASLLVARGDLLLEPSLVQYSDVASHQATTRAASDT
LGFGSESAVFYKTSMVSQIESPRSDVVMHAYSSGPEPSYTVEGSHHVPTVSYSSAMPLHG
SVDVSDQGSLLINPSHISMPESSFITPTASLLQPPPALSGDGEWSGASSDSELLLPDADG
LRTLNISSPVSVAEFTYTTSVFADGIKPLSKSEMMYGNETELKMSSFSDMAYPSKSTVVP
KMSDVVHKWSESLKETSVSISSMKSVFPESLVYPTTKGFEQGVSHVPEIIFPVQPTHTAS
QASGDTWLKPGLSANSEAAFSDTASREVVHPSTQPLLYEAATPFNTEALLQPSFQASDVD
TLLKTALPSVPSDPILAGTPQVEQSSSSVSHPMASESGSSESMLHFTSVPILDISPSKVH
STPLQGLTVPHSSKKFSEQGLLKSKSPQQVLPSLFSNDEFFQSAHLDVSQAYPPKGRHAF
VTPVLSIDEPQNTLINKLVYSEDIFSSTEISITDKVLTGLPTLASDVLSSTDHSVPLGSG
PISLTMVSPNRDDSVTTAKLLLPSTATSKLTQSARSDADLVGGGEDGDDYDDDDYDDIDR
GRFPVNKCMSCLPYRESREKVMNDSDTQESSLVDQSDPISPLLFENTEEENGGTGVTRVD
KSPPPSMLPQNHNDGKEDSDIQMGSAVLPHTPGSKAWAVLTSDEESGSGQGTSDSLNDNE
TSTDFSFPDVNEKDTDGVLETDDTGIAPGSPRSSTPSVTSGHSGVSNSSEAEASNSSHES
RIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDNTSPRVIS
TPPTPIFPISDDIGAIPIKHFPKHVADLHASNGFTEEFETLKEFYQEVQSCTADLGITAD
SSNHPDNKHKNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGP
LKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKSVQVLA
YYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKR
HAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYV
FIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPTGKTKLEKQFQLLSQSNILQSDYSTA
LKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLLHTI
KDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMSEEHKCLSNEE
KLIVQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHD
EHGGVTAGTFCALTTLMHQLEKENAMDVYQVAKMINLMRPGVFTDIEQYQFLYKVVLSLV
STRQEENPSTSLDSNGAALPDGNIAESLESLV
NT seq 6939 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcctgcagagcttcctcgcgtgcgttcagctcctgtgcctgtgtcgcctggac
tgggcttatggatactacagacaacagaggaaacttgttgaagagattggctggtcctac
acaggagcactaaatcaaaaaaattggggaaagaaatatccaatatgtaatagcccaaag
cagtctcctattaatattgatgaagatcttacacaagtcaatgtgaatcttaagaaactg
aaatttcagggttgggaaaaagcgtccttggaaaacacgttcattcacaacactgggaaa
acagtggaaataaatctcactaatgactactatctcagtggaggactttcagaaaaggtc
ttcaaggcaagcaagataactttccactggggaaaatgcaatgtgtcatctgaaggatcg
gaacatagcttagaaggacagaagttcccactggagatgcaagtctactgctttgatgcg
gacagattttccagttttgaggaagcagttaaaggaaaaggaagattaagggctttatcc
attttatttgaggttggagttgaagaaaatttggattacaaagccattattgatggaact
gagagtgttagtcgttttggaaagcaggctgctttagatccattcgtcttgcagaacctc
ctgccaaactccactgacaagtattacatttacaatggatcattgacatcccctccctgc
acagacaccgtggaatggattgtttttaaggatacagttagcatctctgaaagccagctg
gctgtattttgtgaagttctcacaatgcaacagtctgggtatgtcatgttgatggattac
ttacaaaacaatttccgagaacaacagtacaagttttccaggcaggtgttttcctcatat
actggaaaggaagagatccacgaagtagtgtgtagttcagaaccagaaaatgtgcaagct
gaccctgagaattacaccagccttctggtcacatgggaaagacctcgggtcgtttatgac
gccatgattgagaagtttgcagttctgtaccagccactggcgggaaatgaccaagccaag
catgagttcttaacagatggctatcaggacttgggtgccattctcaataatttactacct
aacatgagttacgttcttcaaatagtggccgtatgctctaatggtttatatggaaagtac
agtgaccaactgatagtggacatgcccactgaagatgccgaacttgacctttttcctgaa
ttaattgggactgaagaaataatcaaggaggaagaatatggaaaagacaatgaagaagac
actggcttgaatcctggtagagacagtgtcacaaaccaaataaggaaaaaggaaccccag
gtttctaccacgactcactataatcacatggggactaaatacaatgaagccaagactaac
cgatctccaacaagaggatctgaattctctggaaagagtgatgttcccaacacttccccg
aattctacttcccaacatgttgctgaattcgaaacagaaagaggaatttccttgccttct
cagactggaactaacctgccaccacacaatgtggaaggcacttcagcctccttaaacagt
ggctctaaaactctctttatcttcccacagatgaacttgtctgggactgcagaatcctta
aatacggttcccataacagagtacaaagaggtttctgctgacgtcagtgaggaagaaaac
ttcctgactgatttcaagctcgatacgggagccgatgactcttcaggctccagcccctca
acctccactgtccccttttcctcagataatctatcccatggatacataacttcttcagac
atgcccgaggctatcacgtatgatgtccttaagccaggatctacaagaaatgccccagag
gattcagctccatcaggttcagaggaatcactaaaggatccatctcttgaagggagtgta
tggtttcctggctccacagacctaacaacgcagtctgagactggatccggccgagagagc
tttctccaggttaactccacagacatacaaattgatgaatcgagggagacaaccgagtcg
ttttctccagatgctaccgtgtcacaggatccttcagtcacagacatgggaatgccacat
tattctacctttgcctacctcccaaccgaagtgacaccacaggctttcactccatcctcc
agaccacttgatttggctcctactatcaacatcctccattcgcagacgactcaaccagta
tacaatggtgagacacctcttcaaccttcctacagtagtgaagtctttcctctagccacc
cctttgttgcttgacaatcagaccctcaacactacccctgctgcttcaagtagtgattcg
gccttgcatgctacgcctgtatcccccagtgttggtgtgtcatttgaatccatcctgtct
tcctatgatgatgcacctctgctcccattttcctctgcttccttcagtagtgaaatgttt
cgccatctgcatacggtttctcaaacccttccgcaagtcacttcagctgctgagagggat
gagctgtctttgcatgcttctctgctggtggctaggggtgatttgctgttagaacccagc
cttgttcagtattctgatgtggcgtcacatcaggccactactcgtgctgcttcggacaca
ttgggatttggtagtgagtctgctgtcttttataaaacgtccatggtttctcagattgaa
tcacccagaagtgatgttgttatgcatgcatactcttcggggcctgaaccttcttatacc
gttgagggctcccaccacgtacccactgtttcttacagttctgcaatgcctctgcatggt
tctgtcgatgtatctgatcaggggtccttacttatcaatcctagccatatatcaatgcct
gagtcctcctttattactccaactgcatcattactgcagcctcctccagccctctctggt
gatggggaatggtctggagcctcctctgatagtgaattgcttttacctgacgcagatggg
ctgagaactcttaacatttcttcacctgtttccgtagctgaatttacatatacgacatct
gtgtttgctgatggtattaagccgctctctaaaagtgaaatgatgtatggaaatgagact
gaactgaaaatgtcttctttcagtgacatggcatacccttctaaaagcacagttgtgcca
aagatgtcagatgttgtacataagtggagtgaatctttaaaagaaacctctgtttctatt
tctagcatgaagagtgtgtttccagagtctcttgtttatcccacaactaagggttttgaa
cagggggttagtcacgttccagaaattatcttcccagttcaacctacacacactgcatct
caagcatctggggacacttggcttaaacccgggcttagcgcaaactcagaggcagcgttc
tcagacactgcttctagggaagtagtacacccttcaacacagcccttgctctatgaggcc
gcaactccttttaatactgaagcgttgctgcaaccttcctttcaggcttctgatgttgac
accttgcttaaaactgctctcccatctgtgcctagtgatccaatactggctggaaccccc
caggttgaacaaagtagctcttccgtgtctcatcccatggcatcagagtctggttcaagc
gaaagcatgctgcactttacgtctgtacctattctcgatatatcaccttctaaggtgcac
tccactccacttcaaggcttaacagttcctcactcgagtaagaaattttctgaacaaggt
ttgcttaagagcaaaagtccccagcaagtgctgccatctttgttcagcaatgacgagttt
ttccaaagcgcacatctggacgttagccaggcctatcctccaaaagggaggcatgcattt
gttactcctgttttatcaattgatgaaccacaaaatacgcttataaacaagcttgtgtat
tctgaggacattttctcgagcactgagatttctattactgataaggtacttactggtctc
ccaacgcttgcttctgatgtactttcatctactgaccattctgttccattaggaagtggg
cccatttccttgacaatggtttctcccaacagagatgattctgtgaccacagccaagttg
cttcttccttctacagctacttctaagctgactcagagcgccagatctgatgccgattta
gtgggaggtggtgaagatggtgatgactatgatgatgatgactatgatgacatagatagg
ggtcgctttcctgtgaataagtgtatgtcatgcttgccctatagagaatcccgggaaaag
gtaatgaatgactcggacacccaggagagcagtcttgtggatcagagtgacccaatttca
cctttactctttgagaatacagaagaagaaaatggaggcacaggtgtaactagggtggat
aagtcaccaccaccaagtatgctaccccagaatcacaatgatggaaaagaggacagtgac
atccaaatgggtagtgctgtccttcctcataccccaggatctaaagcgtgggcagttttg
acaagtgatgaagagagtgggtcagggcaaggcacctcagatagccttaatgataatgag
acgtccacagatttcagttttccagatgttaatgaaaaggatactgatggtgtcctggaa
acagatgacacaggcatagctccgggatctccacggtcctccacaccatctgttactagt
gggcactcaggagtatccaacagttcagaggcagaggccagtaatagtagccatgagtct
cgtattggtctagctgaggggttggagtctgagaagaaagcggttataccccttgtgatc
gtgtctgccctgacttttatctgtctagtggttcttgttggtattctcatctattggaga
aaatgcttccagactgctcacttttatttagaagacaatacatcccctcgagtaatatct
acaccaccaacacccatctttccaatttcagatgatattggagcaattccaataaagcat
tttccaaagcacgttgcagatttacatgcaagtaatgggttcactgaagaatttgagaca
ctgaaagagttttaccaggaagtgcagagctgtactgctgacttaggcatcacagcagac
agctccaatcacccagacaacaagcacaagaacagatacgtcaatatcgtagcctatgat
catagcagggttaagctcacacaacttgctgaaaaagatggaaaactgactgattacatc
aatgccaattatgttgatggttacaacagaccaaaggcttacattgctgcccagggtcca
ctgaagtccacagctgaagacttctggagaatgatctgggagcataatgtggaagtcatc
gtcatgatcacaaacctcgtggagaaaggaagaagaaaatgtgaccagtactggcctact
gatggtagtgaagaatatgggagcttcctagtcaaccaaaagagtgttcaggtgcttgct
tattatactgtgaggaatttcaccctaagaaacacaaagttaaagaagggctctcagaaa
ggaagatccagtgggcgcctagtcacacagtatcattacacccagtggcctgacatgggt
gttcccgagtactccctgcccgtgctggcctttgtgagaaaggctgcccaggccaagcgc
catgcagtcgggccagttgttgtccactgcagtgctggcgtggggagaacggggacatac
attgtgctagacagtatgctgcagcagattcaacatgaaggaaccgtcaacatatttggc
ttcttaaagcacattcgttctcaaaggaattatttggtgcaaacagaggagcagtatgtc
ttcattcacgatacactggtcgaggccatactcagcaaggaaacggaggtacctgacagc
cacattcactcctatgttaatacactcctcatacccggaccaacaggcaagacaaaacta
gagaaacaattccagcttctgagtcagtcaaatatcctccagagtgactactccacagcc
ctgaagcagtgtaacagggagaagaacagaacatcgtccatcatccctgtggaaagatca
agggtgggcatttcatccctgagtggggaaggcacagactacatcaatgcatcctatatt
atgggctattaccagagcaatgaattcatcatcacccagcatcccctgctgcacaccatc
aaggacttctggagaatgatatgggatcataatgcccagctggtggttatgattccagat
ggtcaaaacatggcagaggatgagtttgtctactggccaaataaagatgagcccataaat
tgtgaaagcttcaaagtcacgcttatgtctgaagaacacaaatgcctttcgaacgaggaa
aaactgatcgttcaagacttcatcttggaagcaacacaggatgactatgtgctggaagta
aggcatttccagtgccccaaatggccaaatccggatagtcccattagtaaaacatttgaa
cttataagtattatcaaagaagaagctgctaacagggatgggcccatgattgttcacgat
gagcacgggggagtaacagcaggaactttttgtgctcttacaacccttatgcaccaacta
gaaaaagaaaacgccatggatgtttaccaagtagccaagatgatcaatttgatgaggccg
ggagtcttcactgacattgagcagtatcagtttctgtacaaagtagtcctcagcctcgtc
agcacaaggcaggaagagaacccatccacctctctggacagtaatggtgcagctttgcct
gatggaaatatagctgaaagcctggaatctttagtctaa

DBGET integrated database retrieval system