KEGG   Mus musculus (mouse): 19286
Entry
19286             CDS       T01002                                 

Symbol
Pts, PTPS
Name
(RefSeq) 6-pyruvoyl-tetrahydropterin synthase
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    19286 (Pts)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    19286 (Pts)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     19286 (Pts)
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     19286 (Pts)
Transfer RNA biogenesis [BR:mmu03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    19286 (Pts)
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-GeneID: 19286
NCBI-ProteinID: NP_035350
MGI: 1338783
Ensembl: ENSMUSG00000032067
Vega: OTTMUSG00000063068
UniProt: Q9R1Z7
Position
9; 9 A5.3
AA seq 144 aa
MSAAGDLRRRARLSRLVSFSASHRLHSPSLSDEENLRVFGKCNNPNGHGHNYKVVVTVHG
EIDPVTGMVMNLTDLKEYMEEAIMKPLDHKNLDLDVPYFADAVSTTENVAVYIWESLQKL
LPVGALYKVKVFETDNNIVVYKGE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcgcggcgggtgaccttcgtcgccgcgcgcgactgtcgcgcctcgtgtccttcagc
gcgagccaccggctgcacagcccatctctgagcgatgaagagaacttaagagtgtttggg
aaatgcaacaatccgaatggccacgggcacaactataaagttgtggtgacagtccatgga
gagattgatcctgttacaggaatggttatgaatttgaccgacctcaaagaatacatggag
gaggccatcatgaagcctcttgatcacaagaacctggacctggatgtgccgtactttgcg
gatgctgtgagcacgacagaaaatgtagctgtctacatctgggaaagcctccagaaactt
cttccagtgggagctctttataaagtaaaagtgtttgaaaccgacaacaacatcgtagtc
tataaaggagaatag

DBGET integrated database retrieval system