KEGG   Mus musculus (mouse): 19288Help
Entry
19288             CDS       T01002                                 

Gene name
Ptx3, AI607804, TSG-14
Definition
(RefSeq) pentraxin related gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Pentaxin Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 19288
NCBI-ProteinID: NP_033013
MGI: 104641
Ensembl: ENSMUSG00000027832
Vega: OTTMUSG00000043511
UniProt: P48759
Position
3 E1; 3 30.25 cM
AA seq 381 aa AA seqDB search
MHLPAILLCALWSAVVAETSDDYELMYVNLDNEIDNGLHPTEDPTPCDCRQEHSEWDKLF
IMLENSQMREGMLLQATDDVLRGELQRLRAELGRLAGGMARPCAAGGPADARLVRALEPL
LQESRDASLRLARLEDAEARRPEATVPGLGAVLEELRRTRADLSAVQSWVARHWLPAGCE
TAIFFPMRSKKIFGSVHPVRPMKLESFSTCIWVKATDVLNKTILFSYGTKWNPYEIQLYL
SSQSLVLVVGGKENKLAADTVVSLGRWSHLCGTWSSEQGSMSLWANGELVATTVEMAKSH
SVPEGGLLQIGQEKNGCCVGGGFDESLAFSGRITGFNIWDRVLSEEEIRASGGVESCHIR
GNVVGWGVTEIQAHGGAQYVS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcacctccctgcgatcctgctttgtgctctctggtctgcagtagtggctgagacctcg
gatgactacgagctcatgtatgtgaatttggacaacgaaatagacaatggacttcatccc
accgaggaccccacgccatgcgactgccgccaggagcactcggagtgggacaagctgttc
atcatgctggagaactcgcagatgcgggagggcatgctgttgcaggccaccgacgacgtc
ctccgtggagagctgcagcggctgcgggcagagctggggcggctggcgggcggcatggcg
aggccgtgcgcagccggtggccccgcagacgccaggctggtgcgggcgctggagccgctg
ctgcaggagagccgtgacgcgagcctcaggctggcgcgcctggaggacgcggaggcgcgg
cgacccgaggcgacagtgcctggcctaggcgctgtgctggaggaactgcggcggacgcgc
gccgacctgagcgccgtgcagagctgggtcgcccgccactggctgcccgcaggttgtgaa
acagcaattttcttcccaatgcgttcgaagaagatttttggaagcgtgcatcctgtgaga
ccaatgaagcttgaatcttttagtacttgcatttgggtcaaagccacagatgtattaaac
aaaaccatcctgttttcttatggcacaaagtggaacccctatgagattcagctgtacctc
agttcccagtccctagtgttggtggtgggtggaaaggagaacaagctggctgcagacact
gtggtgtccctggggaggtggtcccacctgtgtggcacctggagttcagagcaggggagc
atgtccctgtgggcaaacggggagctggtggctaccactgtagagatggccaaaagtcac
tctgttcctgagggtggactcctacagattggccaagaaaagaatggttgctgtgtaggt
gggggctttgacgaatcattagcattttctggaagaatcacaggcttcaatatctgggat
cgggttctcagcgaggaggagatacgggccagtggaggagtcgaatcctgtcacatccgg
ggaaatgtcgtcgggtggggagtcacagagattcaggcgcacggaggagcccagtatgtt
tcttaa

DBGET integrated database retrieval system