KEGG   Mus musculus (mouse): 19293
Entry
19293             CDS       T01002                                 

Symbol
Pvalb, PV, Parv, Pva
Name
(RefSeq) parvalbumin
  KO
K23926  parvalbumin alpha
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    19293 (Pvalb)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   19293 (Pvalb)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Toprim_2 SPARC_Ca_bdg Skp1
Other DBs
NCBI-GeneID: 19293
NCBI-ProteinID: NP_001317615
MGI: 97821
Ensembl: ENSMUSG00000005716
Vega: OTTMUSG00000031047
UniProt: P32848 Q545M7
Position
15 E1; 15 36.93 cM
AA seq 110 aa
MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIE
EDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcgatgacagacgtgctcagcgctgaggacatcaagaaggcgataggagcctttgct
gctgcagactccttcgaccacaaaaagttcttccagatggtgggcctgaagaaaaagaac
ccggatgaggtgaagaaggtgttccatattctggacaaagacaaaagtggcttcattgag
gaggatgagctggggtccattctgaagggcttctcctcagatgccagagacttgtctgct
aaagaaacaaagacgcttctggccgctggagacaaggatggggacggcaagattggggtt
gaagaattctccactctggtggctgaaagctaa

DBGET integrated database retrieval system