KEGG   Mus musculus (mouse): 192976
Entry
192976            CDS       T01002                                 

Symbol
Lrrc75a, Fam21, Fam211a
Name
(RefSeq) leucine rich repeat containing 75A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: T2SSK
Other DBs
NCBI-GeneID: 192976
NCBI-ProteinID: NP_942561
MGI: 2682293
Ensembl: ENSMUSG00000046417
Vega: OTTMUSG00000005865
UniProt: Q7TSF4
Position
11; 11 B2
AA seq 339 aa
MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGSGLPPYHRRVGMVQE
LLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYI
HCPKPEGDAMGAMEKLCRQLTYHLSPHSQWRRHRGLKRKPQACLKALLSGNPPDNMVDLS
GIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGNR
LTRALLRDLTDTLKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILEL
GEGPGTGEEAREGTDQQDPIGSPVTPARGQESTECVIQT
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgggcactcggcagaccaagggcagcctggcggagagagccagccccggcgcggcgccc
ggcccccgccgcgaacgacccgacttctgggcgtcgctgctgctgcgcgccggggacaag
gcggggcgcgcgggcagtgggctacccccctatcaccggcgcgtcggcatggtccaggag
ctgctgcggatggtgcgccagggccggcgggaggaggcggggacgctgctgcagcacctg
cgccaggacctgggcatggagtcaacctccctggatgatgtgctgtaccgctatgccagc
ttccggaacctggtggacccgatcacacacgacctcatcatcagcctggcgcgctacatc
cactgccccaagccggaaggtgatgcaatgggtgccatggagaagctgtgccggcagctg
acctaccaccttagccctcattcacagtggaggaggcaccgagggctgaagaggaagcca
caggcctgccttaaggccctcctatctgggaatcctccagacaacatggtggatctgtca
ggcattccactgacttcaagggacctcgagcgagtgaccagctaccttcagcgctgtgga
gaacaggtggacagcgtggagctgggcttcacaggcctcacagatgacatggttctgcag
ctactgccagctctcagtaccctgcctcgtcttaccacacttgccctcaatggcaaccga
ctgacccgggctctgctgagggacctcactgacaccctgaaggaccccagcaaattcccc
aatgtcacatggattgacctgggcaacaatgtggacatcttctcactaccccagcccttt
ctgctcagcctccggaagcgctctccaaaacagggccacctaccaaccatccttgagctg
ggtgaggggccaggtactggggaagaagccagggaaggtaccgatcagcaggaccctata
gggagtcctgtgacacctgccaggggccaggaaagtacagagtgtgtgattcagacatga

DBGET integrated database retrieval system