KEGG   Mus musculus (mouse): 19298
Entry
19298             CDS       T01002                                 

Gene name
Pex19, Px, Pxf
Definition
(RefSeq) peroxisomal biogenesis factor 19
  KO
K13337  peroxin-19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19298 (Pex19)
SSDB
Motif
Pfam: Pex19 Laminin_I Rod-binding
Other DBs
NCBI-GeneID: 19298
NCBI-ProteinID: NP_075528
MGI: 1334458
Ensembl: ENSMUSG00000003464
Vega: OTTMUSG00000029601
UniProt: Q8VCI5
Position
1 H3; 1 79.54 cM
AA seq 299 aa
MAAAEEGCGVGVEDDRELEELLESALDDFDKAKPSPEHAPTISAPDASGPQKRAPGDTAK
DALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDAS
SQQEFTSCLKETLSGLAKNATELQNSGMSEEELMKAMEGLGMDEGDGEASILPIMQSIMQ
NLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDS
EATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM
NT seq 900 nt   +upstreamnt  +downstreamnt
atggcggctgctgaggaaggttgcggtgttggggtcgaagacgaccgggaactggaggag
cttctggaaagtgctcttgatgatttcgacaaagccaaaccctccccagaacatgctccg
accatctcggctcccgacgcttcaggaccccagaagagagcgccaggagatactgccaaa
gatgctctcttcgcctcccaagagaaatttttccaggaactgtttgacagtgagctggct
tcccaagctactgcggagtttgagaaggcaatgaaggagctggctgaggaagagccccat
ctggtggagcagttccagaagctctcagaggcagctgggagagtgggcagcgatgcaagt
tctcagcaagagtttacttcttgcctaaaggagacgttaagtggcctggccaaaaacgcc
actgagctgcagaactcgggcatgtctgaagaggagctgatgaaagccatggaagggctg
ggcatggatgagggggatggggaagcgagcattctccccatcatgcagagcatcatgcag
aacctcctgtctaaggatgtgctgtacccatccctgaaggagatcacagaaaagtatcca
gaatggctccagagtcaccaggactccactcctcccgagcagtttgagaagtaccagcag
cagcacagcgtcatggtcaaaatctgtgagcagtttgaggccgagacgcccacagacagc
gaggctactcagagggctcgctttgaggccatgctagatctcatgcagcagttacaggcc
ttgggccatcctccaaaagagctggctggggagatgcctcctggcctcaactttgacctg
gatgctctcaatctgtcgggccccccaggtgctaatggcgaacagtgtctgatcatgtga

DBGET integrated database retrieval system