KEGG   Mus musculus (mouse): 19299
Entry
19299             CDS       T01002                                 

Gene name
Abcd3, AI313901, AU018866, AW146054, PMP, PMP68, PMP70, Pxm, Pxmp1
Definition
(RefSeq) ATP-binding cassette, sub-family D (ALD), member 3
  KO
K05677  ATP-binding cassette, subfamily D (ALD), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    19299 (Abcd3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19299 (Abcd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    19299 (Abcd3)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD3 subgroup
    19299 (Abcd3)
SSDB
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_23 SMC_N AAA_29 Rad17 AAA_21 AAA_16 AAA_27 AAA_18 AAA_5
Other DBs
NCBI-GeneID: 19299
NCBI-ProteinID: NP_033017
MGI: 1349216
Ensembl: ENSMUSG00000028127
Vega: OTTMUSG00000031086
UniProt: P55096
Position
3 G1; 3 52.94 cM
AA seq 659 aa
MAAFSKYLTARNTSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVD
KVFLSRLSQILKIMVPRTFCKETGYLLLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSK
DFKRYLFNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDN
RIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVS
GLFLTRLRRPIGKMTIMEQKYEGEYRYVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLV
EHLHNFIFFRFSMGFIDSIIAKYVATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQS
GRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGRYERTMVSQQEKGIEG
AQASPLVPGAGEIINTDNIIKFDHVPLATPNGDILIQDLSFEVRSGANVLICGPNGCGKS
SLFRVLGELWPLFGGRLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGKEDQKKRGISDQ
VLKEYLDNVQLGHILEREGGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSA
VSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKKITEDTVEFGS
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggcggccttcagcaagtacttgacggcacggaacacctcgctggcgggggccgcgttc
ctgctgctctgcctactccataagcggcgtcgcgccctcggcctgcacggtaagaaaagt
ggaaaaccgccattacagaataatgagaaagaaggaaagaaagagcgagctgtggtggac
aaagtgtttttatcaaggctctcacagatcctaaaaattatggttcctagaacattttgt
aaagagacaggctacttgttacttattgcggttatgctggtatctcgaacatactgtgat
gtttggatgattcagaatgggacgctcattgagagtggcatcattggtcgcagcagcaaa
gatttcaagagatacttattcaacttcatcgctgccatgcctcttatctctctggttaat
aacttcttgaagtatgggttaaatgagctcaaactgtgcttccgagtcaggctcacacgg
tacctctacgaggagtatctccaagctttcacctattataaaatgggcaacctggataac
agaatagcaaatccagaccagctgcttacacaggatgtagaaaaattttgtaacagtgta
gtcgatctgtattcaaatcttagtaagccatttttagacatagttttatatattttcaag
ttaacaagtgcaattggagctcagggcccggcaagcatgatggcctacttgcttgtttct
gggctattcctaactcgactcagaagacccattggtaagatgacaattatggagcagaag
tacgaaggagaatacagatacgtgaattcacggcttatcactaatagtgaagaaattgcc
ttttacaatgggaataaacgggagaagcagacaatccactcagtcttccgaaaactggtg
gaacacctacataatttcattttctttcggttttctatgggtttcattgatagcatcatt
gccaaatatgttgccactgtcgtcgggtacctggttgtcagtcgccccttcctagatctg
gcacaccctcgccaccttcacagcacacactcagagctgctggaggattactaccaaagt
ggaaggatgcttttgagaatgtctcaagctttgggtcgtatagttttggctgggcgtgaa
atgactagattggctggttttacggctcggattacagaattaatgcaagtactaaaggac
ttaaatcatggcagatatgaacgtacaatggtgtcacaacaggagaagggtattgaagga
gcacaagctagtcccttggtccctggtgctggagaaatcatcaatacagacaacattata
aagtttgatcatgttcctttagcaacaccaaatggtgacatcttgatccaagaccttagt
tttgaagttcgatctggggccaacgttctgatttgtggtccaaacggctgtggaaagagc
tccctcttccgtgttcttggtgagttatggcctctttttggagggcggcttactaaacct
gagagaggaaagttattttatgttcctcagcgaccctatatgaccctgggaacactgaga
gaccaagtcatatatccagatggaaaggaagatcagaagaagagggggatctctgaccag
gtgctgaaggagtacttggacaatgtgcagctgggtcacatccttgagcgagaaggcggc
tgggacagtgttcaggactggatggatgtactcagcggaggagagaaacaaagaatggcg
atggcaagactgttttatcataaaccccagtttgccattttggatgaatgcacaagtgcg
gtcagtgtggatgtggaggactacatttacagccactgtcgaaaggttggcatcaccctc
tttaccgtttcacacagaaagtccctttggaagcaccacgagtactacctgcatatggat
gggagaggcaattatgaattcaaaaagatcacagaagatacagttgagttcggatcatag

DBGET integrated database retrieval system