KEGG   Mus musculus (mouse): 193003
Entry
193003            CDS       T01002                                 

Gene name
Pirt, A530088H08Rik, P
Definition
(RefSeq) phosphoinositide-interacting regulator of transient receptor potential channels
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PIRT Neurensin TMEM100 DUF872 DUF2157 Phage_holin_3_6 TMEM174 DUF2663 KASH CrgA ATP19
Other DBs
NCBI-GeneID: 193003
NCBI-ProteinID: NP_848771
MGI: 2443635
Ensembl: ENSMUSG00000048070
Vega: OTTMUSG00000005913
UniProt: Q8BFY0
Position
11; 11 B3
AA seq 135 aa
MEVLPKALEVDERSPESKDLLPSQTASSLCISSRSESVWTTTPKSNWEIYHKPIIIMSVG
AAILLFGVAITCVAYILEEKHKVVQVLRMIGPAFLSLGLMMLVCGLVWVPIIKKKQKQRQ
KSNFFQSLKFFLLNR
NT seq 408 nt   +upstreamnt  +downstreamnt
atggaggtgctccccaaggccctggaggtagacgagaggtctccagagtccaaggacctg
ctgcccagccagacagccagctccctgtgcatcagttccagaagtgagtctgtctggacc
accacacccaaaagcaactgggaaatctaccacaagcccatcatcatcatgtcagtggga
gctgccattctgctctttggcgtggccatcacctgtgtggcctacatcttggaagagaag
cataaagttgtgcaagtgctcaggatgatagggcctgccttcctgtccctgggactcatg
atgctggtgtgtgggctggtgtgggtccccataatcaaaaagaagcagaagcaaaggcag
aagtccaacttcttccaaagcctcaagttcttcctcctgaaccgctga

DBGET integrated database retrieval system