KEGG   Mus musculus (mouse): 19301
Entry
19301             CDS       T01002                                 

Gene name
Pxmp2, 22kD, 22kDa, PMP, PMP22
Definition
(RefSeq) peroxisomal membrane protein 2
  KO
K13347  peroxisomal membrane protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19301 (Pxmp2)
SSDB
Motif
Pfam: Mpv17_PMP22 WSK
Other DBs
NCBI-GeneID: 19301
NCBI-ProteinID: NP_033019
MGI: 107487
Ensembl: ENSMUSG00000029499
Vega: OTTMUSG00000026216
UniProt: P42925 Q5D073
Position
5 F; 5 53.44 cM
AA seq 193 aa
MAPAASRLRVESELGSLPKRALAQYLLLLKLYPVLTKAVSSGILSALGNLLAQTIEKRKK
DSQNLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYSVPPEVPWASVKRLLLDRLFFAPTFL
LLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMA
ALFWYAYLASLGK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcacctgcggcgtccaggctgcgggtggaatccgagctcgggtcgcttcccaagcga
gcgctcgcccaatacttgctgctcctaaagctctacccggtgctcaccaaagcagtcagc
agcggcattttgtcagcccttggaaaccttctggcccagacgattgagaagcggaaaaaa
gactctcaaaatctagaagtcagtgggcttctcagatatttagtttatgggttgtttgtc
acaggtccactgagtcactacctctacctcttcatggaatactcggtccctcctgaggtt
ccctgggccagcgtcaagaggctcctgctggatcgcctgttctttgccccaacttttctg
ctgctgttcttcttcgtcatgaacttgctggaggggaaaaacgtcagtgtctttgttgcc
aagatgaggagtggcttctggcccgcactgcaaatgaactggaggatgtggacacctttg
cagttcattaacatcaactatgtgcccctgcagttccgggtgctctttgccaacatggca
gctctgttctggtatgcctacctggcgtctctggggaagtga

DBGET integrated database retrieval system