KEGG   Mus musculus (mouse): 193034Help
Entry
193034            CDS       T01002                                 

Gene name
Trpv1, OTRPC1, TRPV1alpha, TRPV1beta, VR-1, Vr1
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 1
  KO
K05222  transient receptor potential cation channel subfamily V member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    193034 (Trpv1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    193034 (Trpv1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    193034 (Trpv1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   193034 (Trpv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ion_trans Ank_3 Ank_5 Ank Ank_4
Motif
Other DBs
NCBI-GeneID: 193034
NCBI-ProteinID: NP_001001445
MGI: 1341787
Ensembl: ENSMUSG00000005952
Vega: OTTMUSG00000006125
UniProt: Q704Y3 Q3V318
Position
11 B4; 11 45.25 cM
AA seq 839 aa AA seqDB search
MEKWASLDSDESEPPAQENSCPDPPDRDPNSKPPPAKPHIFATRSRTRLFGKGDSEEASP
MDCPYEEGGLASCPIITVSSVVTLQRSVDGPTCLRQTSQDSVSTGVETPPRLYDRRSIFD
AVAQSNCQELESLLSFLQKSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDI
ARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAANGDFFKKT
KGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTA
DNTKFVTNMYNEILILGAKLHPTLKLEELTNKKGLTPLALAASSGKIGVLAYILQREIHE
PECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLN
RLLQDKWDRFVKRIFYFNFFVYCLYMIIFTTAAYYRPVEGLPPYKLNNTVGDYFRVTGEI
LSVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSHRKEYVA
SMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLI
EDGKNNSLPVESPPHKCRGSACRPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVF
IILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKA
FRSGKLLQVGFTPDGKDDFRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRS
GRVSGRNWKNFALVPLLRDASTRDRHSTQPEEVQLKHYTGSLKPEDAEVFKDSMAPGEK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatgggctagcttagactcggatgaatctgagcccccagcccaagagaactcc
tgcccggaccctccagacagagaccctaactccaagccgcctccagccaagccccacatc
tttgctaccaggagtcgcacccggctttttgggaagggtgactcagaagaggcctctccc
atggactgcccttatgaggaaggcgggctggcctcctgccctatcatcaccgtcagctct
gttgtcactctccagaggtctgtggatggacctacctgtctcaggcagacatcccaggac
tctgtctccactggtgttgagacgcccccaaggctctatgatcgcaggagcatcttcgac
gctgtggctcagagcaactgccaggagctggagagcctgctgtccttcctgcagaagagc
aagaagcgcctgactgacagcgagttcaaagacccagagacgggaaagacctgtctgctc
aaagccatgctcaatctgcacaatgggcagaacgacaccattgctctgctcctggacatt
gcccggaagacagatagcctgaagcagtttgtcaatgccagctacacagacagctactac
aagggccagacagcattacacattgccattgaaaggcggaacatggcactggtgaccctc
ttggtggagaatggagcagatgtccaggctgctgctaacggggacttcttcaagaaaacc
aaagggaggcctggcttctactttggtgagctgcccctgtccctggctgcgtgcaccaac
cagctggccattgtgaagttcctgctgcagaactcctggcagcctgcagacatcagtgca
cgggattcggtgggcaacacggtgctgcacgcccttgtggaggtggcagataacacagct
gacaacaccaagttcgtgacaaacatgtacaacgagatcctgatcctgggggccaaactc
caccccacactgaagctagaagaactcaccaacaagaaggggcttacaccgctggctctg
gctgccagcagtgggaagattggggtcttggcctacattctccagagggagatccacgaa
ccagagtgccggcacctgtccaggaagttcactgaatgggcctatgggcccgtgcactcc
tccctttatgacctgtcctgcattgacacctgtgagaagaattcagtgctggaggtgatc
gcctacagtagcagtgagacccccaaccgccacgacatgcttctcgtggagcccttgaac
cgactcctgcaggacaagtgggacagatttgtcaagcgcatcttctacttcaacttcttc
gtctactgcttgtatatgatcatcttcaccacggctgcttactatcggcctgtggaaggc
ttgcccccctataagctgaataacaccgttggggactatttccgtgtcactggagagatc
ctgtctgtgtcaggaggagtctacttcttcttccgagggatccagtatttcctgcagagg
cgaccatccctcaagagtttgtttgtggacagctacagtgagatacttttctttgtacag
tcactgttcatgctggtgtctgtggtactgtacttcagccatcgcaaggagtatgtggct
tccatggtgttctccctggccatgggctggaccaacatgctctactacacccgaggattc
cagcagatgggcatctatgctgtcatgattgagaagatgatcctcagagacctgtgtcgg
tttatgttcgtctacctcgtgttcttgtttggattttccacagccgtagtgacactgatc
gaggatgggaagaataactcactgcctgtggagtccccaccacacaagtgtcggggatct
gcctgcaggccaggtaactcttacaacagcctgtattccacatgtctggagctgttcaag
ttcaccatcggcatgggtgacctggagttcaccgagaactatgacttcaaggctgtcttc
atcatcctgttactggcctatgtgattctcacctacatcctcctgctcaacatgctcatt
gctctcatgggcgagactgtcaacaagattgcacaagagagcaagaacatctggaagctg
cagcgagccatcaccatcctggatacagagaagagtttcctgaagtgcatgaggaaggcc
ttccgctccggcaagctgctgcaggtggggttcacgccggacggcaaggatgacttccgg
tggtgcttcagggtggatgaggtgaactggactacctggaacaccaacgtgggcatcatc
aacgaggacccaggcaactgtgagggcgtcaagcgcaccctgagcttctccctgcggtca
ggccgagtttcagggagaaactggaagaactttgccctggttccccttctgagggacgca
agcactcgagataggcatagcacccagccggaagaagttcagctgaagcactatacggga
tcccttaagccagaggatgctgaggtcttcaaggattccatggccccaggggagaaatga

DBGET integrated database retrieval system