KEGG   Mus musculus (mouse): 19305
Entry
19305             CDS       T01002                                 

Gene name
Pex5, AW212715, ESTM, ESTM1, PT, PTS1-BP, PTS1R, PXR1P, Px, Pxr1, X83306
Definition
(RefSeq) peroxisomal biogenesis factor 5
  KO
K13342  peroxin-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19305 (Pex5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19305 (Pex5)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    19305 (Pex5)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_17 TPR_14 TPR_16 TPR_19 TPR_12 TPR_7 TPR_9 TPR_20 TPR_10 ANAPC3 Nsp1_C DUF1641
Other DBs
NCBI-GeneID: 19305
NCBI-ProteinID: NP_001264734
MGI: 1098808
Ensembl: ENSMUSG00000005069
Vega: OTTMUSG00000023142
UniProt: O09012
Position
6 F2; 6 59.15 cM
AA seq 639 aa
MAMRELVEGECGGANPLMKLATHFTQDKALRQEGLRPGPWPPGASAAETVSKPLGVGTED
ELVSEFLQDQNATLVSRAPQTFKMDDLLAEMQEIEQSNFRQAPQRAPGVADLALSENWAQ
EFLAAGDAVDVAQDYNETDWSQEFIAEVTDPLSVSPARWAEEYLEQSEEKLWLGDQEGSS
TADRWYDEYHPEEDLQHTASDFVSKVDDPKLANSEFLKFVRQIGEGQVSLESAAGSGGAQ
AEQWAAEFIQQQGTSEAWVDQFTRPGNKIAALQVEFERAKSAIESDVDFWDKLQAELEEM
AKRDAEAHPWLSDYDDLTSASYDKGYQFEEENPLRDHPQPFEEGLHRLEEGDLPNAVLLF
EAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNRTALMALAVSFTNESL
QRQACETLRDWLRYSPAYAHLVAPGEEGATGAGPSKRILGSLLSDSLFLEVKDLFLAAVR
LDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLMWNKLGATLANGNQSEE
AVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMS
ENIWSTLRLALSMLGQSDAYGAADARDLSALLAMFGLPQ
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcaatgcgggagctggtggagggcgaatgtgggggtgccaacccgctgatgaagctg
gccacccatttcacccaggacaaggcccttcggcaggagggactgaggcctggcccctgg
cctccgggagcctcagcagcagagaccgtttccaagcctttgggagtaggaactgaagac
gagttggtgtcagaattcctgcaggaccagaatgcaactcttgtatcccgagcccctcag
accttcaagatggatgacctcctggcagagatgcaggagattgaacagtcaaactttcgc
caggctcctcagagagcccctggtgtggcagatttggccttgtctgagaattgggcccag
gagtttcttgcagctggagatgctgtggatgtagctcaagattataatgagaccgactgg
tcccaagaattcatcgccgaagttacagacccactgtccgtgtcccctgcccgatgggct
gaggagtatctggagcagtctgaggagaagctgtggttgggagaccaggaaggatcctct
accgctgatcgatggtacgatgaatatcatcctgaggaggacctgcagcacacagccagt
gactttgtgtccaaggtggacgaccccaaattggctaactctgagttcctgaaattcgtg
cggcagattggcgaggggcaggtgtccctggagtcggctgcagggtcgggcggagctcag
gcagaacagtgggcagcagagtttatacagcagcagggcacgtcagaggcctgggttgat
cagtttacaagaccaggaaacaaaatagctgcccttcaggtggaatttgaacgagccaag
tcagctatagagtctgatgtcgatttctgggacaagttacaggcagagttggaggagatg
gccaagcgggatgccgaggcgcacccctggctttctgactatgatgacctcacatccgct
tcctatgacaagggttaccagtttgaggaggagaatcccttgcgtgaccaccctcagcct
tttgaagaagggctgcatcgactggaggagggagacctgcccaatgctgtgttgctcttc
gaggctgctgtgcagcaggatcctaagcacatggaagcttggcagtacctgggcaccacc
caggccgagaatgagcaagagctcttggctatcagtgccctgcggaggtgtctggaacta
aagccagataaccggacagcactgatggcgctggctgtgagctttaccaatgagtccctg
cagcgccaggcctgtgagacgttgagggactggctgcgctactcaccggcctacgctcat
ctggtggctcctggggaagaaggggcgaccggggcaggccccagcaagcgcatcttggga
tctctgttgtctgactccctgtttcttgaagtaaaagatctcttcctggcggctgtgcgt
ctggaccctacatccattgaccctgatgtgcagtgtggcctgggagtcctcttcaacctg
agcggggagtacgacaaggctgtggactgtttcacagctgccctcagtgttcgccccaat
gactatttgatgtggaacaagcttggggccaccctggccaatgggaaccagagtgaagaa
gcagtggctgcataccgccgagcccttgaactacagcctgggtatattcggtcccggtat
aacctaggcatcagctgcatcaacctgggagctcaccgtgaggctgtggagcactttctg
gaggctctgaacatgcagaggaagagccggggccctcggggtgaggggggcgccatgtct
gagaacatctggagtaccctgcgcttggcgttatccatgttaggccagagcgatgcctat
ggggcagccgatgctcgggatctgtctgccctcctagctatgtttggcctgccccagtga

KEGG   Mus musculus (mouse): 58869
Entry
58869             CDS       T01002                                 

Gene name
Pex5l, 1700016J08Rik, PX, PXR2, Pex, Pex2, TRI, TRIP8b, pex5Rp
Definition
(RefSeq) peroxisomal biogenesis factor 5-like
  KO
K13342  peroxin-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    58869 (Pex5l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    58869 (Pex5l)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    58869 (Pex5l)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 TPR_19 TPR_17 TPR_14 TPR_9 TPR_12 TPR_20 TPR_16 ANAPC3 DUF4248 DUF596 DUF6391
Other DBs
NCBI-GeneID: 58869
NCBI-ProteinID: NP_001156988
MGI: 1916672
Ensembl: ENSMUSG00000027674
Vega: OTTMUSG00000023437
UniProt: Q8C437 F8SLP9 F8SLQ1
Structure
PDB: 
4EQF

Position
3; 3 A3
AA seq 567 aa
MYQGHMQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLSEPVS
QTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQLEKWDD
VKFHGDRTSKGHLMAERKSCSSRTGSKELLWSAEHRSQPELSTGKSALNSESASELELVA
PAQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISEN
QEAQNQVTVSASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGD
AEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKN
WIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTG
LGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQP
GFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALS
LMDQPELFQAANLGDLDVLLRAFNLDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtaccagggacacatgcagctggtgaatgagcaacaagagagcagacccctcctgagc
ccctccatcgacgacttcctctgcgaaaccaaatcggaggccattgcaaagccagtgaca
tccaacacagccgtgttgaccactggcttggatctccttgacctgagtgaacccgtctct
caaacccaaaccaaagccaagaaatctgagccctcatcaaagagctcgtccctcaagaag
aaagctgatggctccgacctcatcagtgcagatgctgagcagagagcacaggctctccga
gggccagagacatcatccttagatttagacattcaaacacaactggaaaaatgggatgat
gtcaagtttcacggtgaccgaacaagcaaggggcatctcatggcagaaaggaaatcatgc
tcttccagaactgggtccaaagagcttctttggtccgcagaacacagatctcagccagag
ctgagtactgggaaaagcgccctcaactctgagtcggcttccgagttggaacttgtagct
ccagcacaggctcggctgaccaaagagcatcgctggggaagtgccctgctctccaggaac
cattccttggaagaggagtttgaaagggcaaaagcggcagtagagtcagatacagagttc
tgggataagatgcaggcagaatgggaggaaatggcccggaggaactggatatccgagaac
caggaagctcagaaccaagtcaccgtctcggccagtgagaagggatattacttccacact
gaaaatcccttcaaggactggcctggagcatttgaagaaggcttaaaaaggttgaaggaa
ggggacctgcctgtcaccatcctgttcatggaagctgcaattcttcaggaccctggagac
gctgaggcatggcagtttcttggtataacccaggctgagaatgaaaatgagcaggcagct
attgtcgccctccagaggtgcctggagttgcagcccaacaacttgaaggctctgatggcc
ttggctgtaagttacaccaacaccagccaccagcaggatgcttgtgaggcactgaagaac
tggattaagcaaaacccaaagtacaagtaccttgtgaagaacaagaaaggctctccaggc
ctcacacggcggatgtctaaatccccagttgacagctctgttctggaaggagtgaaggag
ttgtacctggaagctgcccaccaaaatggtgacatgattgacccagacctgcagacaggt
ctgggagttctgttccacctgagtggagagttcaatagagcaatcgatgcatttaatgct
gccttaacagttcggccagaggattactcactgtggaaccgtcttggggcaaccttggca
aatggagaccgcagtgaggaagctgtggaggcctacacgagagcactggagatccagcca
ggtttcatccgctccagatacaacctggggatcagctgcatcaacctgggtgcctacaga
gaagcggtcagcaacttcctcactgccctcagcttgcagaggaagagcaggaaccagcag
caagtccctcaccctgccatctccgggaacatctgggccgccctcaggattgccctgtcg
ctgatggaccagccggagctcttccaggccgccaacctcggtgacttggatgtcctcctg
agagctttcaatttggatccttga

DBGET integrated database retrieval system