KEGG   Mus musculus (mouse): 19317
Entry
19317             CDS       T01002                                 

Gene name
Qk, 1110003F05Rik, 1500005P18, QkI, l(17)-1, l(17)-1Wis, l17W, l17Wis1
Definition
(RefSeq) quaking, KH domain containing RNA binding
  KO
K14945  protein quaking
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    19317 (Qk)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    19317 (Qk)
Motif
Pfam: STAR_dimer Quaking_NLS KH_1
Other DBs
NCBI-GeneID: 19317
NCBI-ProteinID: NP_001152989
MGI: 97837
Ensembl: ENSMUSG00000062078
UniProt: Q9QYS9
Structure
PDB: 
4DNN

Position
17 A1; 17 7.75 cM
AA seq 341 aa
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDT
LNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCK
IMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLV
PAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAA
LRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI
LEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggtcggggaaatggaaacgaaggagaagccgaagcccaccccagattatttgatgcag
ctgatgaacgacaagaagctcatgagcagcctgcccaacttctgcgggatcttcaaccac
ctcgagcggctgctggacgaagaaattagcagagtacggaaagacatgtacaatgacacg
ttaaatggcagtacagagaaaagaagtgcagaattgcctgacgcggtgggacccattgtt
cagttacaagagaaactttatgtgcctgtaaaagaataccctgattttaattttgttggg
agaatccttggacctagaggacttacagctaaacaacttgaagcagaaacgggatgtaaa
ataatggtccgaggcaaaggctcaatgagggataaaaagaaggaggagcaaaatagaggc
aagcccaattgggagcatctaaatgaagacttacatgtactaatcactgtggaagatgct
cagaacagagcagaaatcaagctgaagagagcggttgaagaagtgaagaagttactggta
cctgcggctgaaggtgaagacagcctgaagaagatgcagctgatggagcttgcaattctg
aatggcacctacagagacgccaacattaaatcaccagcccttgccttttctcttgcagca
actgcccaggctgctccaaggatcatcactgggcctgcgcctgtcctcccaccagctgct
ctgcgtacacctacgccagctggccctaccataatgcctttgatcagacaaatacagacc
gctgtcatgccaaacggaactcctcacccaactgctgcaatagtccctccagggcctgaa
gctgggttaatctacacaccctatgaatacccctacacattggcaccagctacatcaatc
cttgagtaccctattgaacccagtggtgtgttaggtgcggtggctactaaagttcgaagg
cacgatatgcgtgtccatccttaccaaaggattgtgaccgcagaccgagccgccaccggc
aactaa

DBGET integrated database retrieval system