KEGG   Mus musculus (house mouse): 19324
Entry
19324             CDS       T01002                                 
Symbol
Rab1a, Gtbp, Rab-1, Rab1, Ypt1, mKIAA3012
Name
(RefSeq) RAB1A, member RAS oncogene family
  KO
K07874  Ras-related protein Rab-1A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04140  Autophagy - animal
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    19324 (Rab1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    19324 (Rab1a)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    19324 (Rab1a)
   05022 Pathways of neurodegeneration - multiple diseases
    19324 (Rab1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19324 (Rab1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19324 (Rab1a)
   04031 GTP-binding proteins [BR:mmu04031]
    19324 (Rab1a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    19324 (Rab1a)
 Autophagy
  Other autophagy associated proteins
    19324 (Rab1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19324 (Rab1a)
  Exosomal proteins of other body fluids (saliva and urine)
   19324 (Rab1a)
  Exosomal proteins of colorectal cancer cells
   19324 (Rab1a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    19324 (Rab1a)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA SRPRB AAA FeoB_N PduV-EutP AAA_16 AAA_7 AAA_22 AAA_29 ABC_tran Septin AAA_5 LANC_like TniB Dioxygenase_N
Other DBs
NCBI-GeneID: 19324
NCBI-ProteinID: NP_033022
MGI: 97842
Ensembl: ENSMUSG00000020149
UniProt: P62821 Q0PD67
Position
11:20151412..20176856
AA seq 205 aa
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL
LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA
TAGGAEKSNVKIQSTPVKQSGGGCC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgattct
ggggttggaaagtcctgccttctccttaggtttgcagatgatacgtatacggaaagctac
atcagcacaattggtgtggatttcaagatacgaactatagagttagatgggaaaacaatc
aagctacagatatgggacacagcaggccaggaaagatttcgaacaatcacttccagttat
tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat
aacgttaaacagtggctgcaggagatagatcgctacgccagtgaaaatgtcaacaagttg
ttggtagggaacaaatgtgacctgaccacaaagaaagtagtagactacacaacagcaaag
gaatttgcagattcccttggaattccatttttggaaaccagtgctaagaacgcaacgaat
gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagct
acagctggtggtgccgagaagtccaatgttaaaatccagagcactccagtcaagcagtca
ggtggaggctgctgctaa

DBGET integrated database retrieval system