KEGG   Mus musculus (mouse): 19329
Entry
19329             CDS       T01002                                 

Symbol
Rab17, AW413472
Name
(RefSeq) RAB17, member RAS oncogene family
  KO
K07909  Ras-related protein Rab-17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19329 (Rab17)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19329 (Rab17)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    19329 (Rab17)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    19329 (Rab17)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 CENP-M AAA_24
Other DBs
NCBI-GeneID: 19329
NCBI-ProteinID: NP_001153197
MGI: 104640
Ensembl: ENSMUSG00000026304
Vega: OTTMUSG00000026752
UniProt: P35292 Q0PD39
Position
1 D; 1 45.84 cM
AA seq 214 aa
MAQAAGLPQASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFSNVLPTVGCAFFTKVL
DLGSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQWLEDLEKEF
QPGEVVVMLVGNKTDLGEEREVTFQEGKEFAESKSLLFMETSAKLNYQVSEIFNTVAQEL
LQRAGDTGSSRPQEGEAVALNQEPPIRQRQCCAR
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcgcaggctgctgggctgccacaggccagcactgcttctggccagccctacgtgagc
aagctggttctgcttggaagcagttctgtgggcaagaccagcctggccctccggtacatg
aagcaggacttcagcaatgtcttgccgactgtggggtgtgccttcttcacaaaggtgctg
gacttgggctcctcatctctgaagcttgagatctgggacacagccggccaggagaagtac
caaagcgtctgccacctctacttcaggggtgccaatgctgcgctcctggtttatgacatc
actcggaaggattcctttcacaaggcccagcagtggctggaagacctggagaaggaattc
cagccaggagaggtggtggtgatgctggtcggcaacaaaacggatctgggcgaggagcgg
gaagtgaccttccaggaaggaaaagagtttgcagagagcaaaagcttgctgttcatggaa
acctccgccaagctgaactaccaggtgtctgagatcttcaacactgttgctcaggagctt
ctgcagagagcaggagacacggggagcagccgcccacaggaaggtgaggctgtggctctg
aaccaggaacctcccatcaggcagcgccagtgctgtgcacgatag

DBGET integrated database retrieval system