KEGG   Mus musculus (mouse): 19330
Entry
19330             CDS       T01002                                 

Symbol
Rab18, AA959686
Name
(RefSeq) RAB18, member RAS oncogene family
  KO
K07910  Ras-related protein Rab-18
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19330 (Rab18)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19330 (Rab18)
Membrane trafficking [BR:mmu04131]
 Others
  Rab GTPases of specific organelles
   Lipid droplets
    19330 (Rab18)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab12/18
    19330 (Rab18)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA SRPRB AAA_24 AAA_16 AAA_22 ATP_bind_1 AAA_29 ABC_tran AAA_7 TniB Hpr_kinase_C
Other DBs
NCBI-GeneID: 19330
NCBI-ProteinID: NP_851415
MGI: 102790
Ensembl: ENSMUSG00000073639
UniProt: P35293 Q0PD38
Position
18 A1; 18 4.53 cM
AA seq 206 aa
MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLA
IWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLV
GNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESEN
QNKGVKLSHREESRGGGACGGYCSVL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggacgaggacgtgctgaccactctgaagatactcatcatcggcgagagtggggtgggc
aagtccagcctgctcctgaggttcacagatgatacctttgatccagaacttgcagcaaca
ataggtgttgactttaaggtgaaaacgatttcagtggatggaaataaggctaaacttgca
atatgggatacagctggtcaagagaggttcagaacattaactcccagctattatagaggt
gcacagggagttatattagtctatgatgtcacaagaagagacacctttgttaaactggat
aactggttaaatgaattggaaacatactgtacaagaaatgacatagtaaacatgctagtt
ggaaataaaattgataaggaaaaccgtgaagtcgatagaaatgaaggcttgaaatttgca
cgcaagcattctatgttgttcatagaggcaagtgcaaaaacctgtgatggtgtacagtgt
gcctttgaggagcttgttgagaagatcattcagacacctggcctgtgggaaagtgagaac
cagaacaaaggagtcaagctgtcacacagggaagagagccgcggaggaggcgcctgcggc
ggttactgctctgtgctataa

DBGET integrated database retrieval system