KEGG   Mus musculus (house mouse): 19335
Entry
19335             CDS       T01002                                 
Symbol
Rab23, AW545388, opb, opb2
Name
(RefSeq) RAB23, member RAS oncogene family
  KO
K06234  Ras-related protein Rab-23
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19335 (Rab23)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19335 (Rab23)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    19335 (Rab23)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab23
    19335 (Rab23)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU Gtr1_RagA ATP_bind_1 AAA_7
Other DBs
NCBI-GeneID: 19335
NCBI-ProteinID: NP_001153201
MGI: 99833
Ensembl: ENSMUSG00000004768
UniProt: Q9D4I9
Position
1:33758959..33781645
AA seq 237 aa
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRL
MLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQ
NKIDLLDDSCIKNEEAEGLAKRLKLRFYRTSVKEDLNVSEVFKYLAEKHLQKLKQQITED
PEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRNPFSSCSVP
NT seq 714 nt   +upstreamnt  +downstreamnt
atgttggaggaagatatggaagtggccatcaagatggtggtggtggggaatggggcggtt
ggaaagtcgagcatgattcagcgctactgcaaaggcattttcacaaaagactacaagaaa
accatcggcgtagactttttggagcgacagattcaggttaacgatgaagatgtaaggcta
atgttatgggacactgcaggtcaagaggagtttgatgcaatcacgaaggcctactatcga
ggagcccaggcttgtgtgcttgtgttttctaccacagacagggaatcttttgaagcgatt
tccagctggagagaaaaagtagtagcggaggttggagatataccaaccgcactggtgcaa
aacaagatcgatctgctggatgattcatgcatcaaaaatgaggaagcggagggactggcc
aaaaggctaaagctgaggttctaccggacgtccgtgaaggaggacctcaacgtgagtgaa
gtttttaaatatttggctgagaaacacctacaaaaactcaaacaacaaataaccgaagat
ccagaacagacacactcaagtagtaacaagattggtgtctttaatgcatcggtcagaagt
cacttgggccagaattcaagttcccttaatggtggcgatgtcatcaaccttagacctaac
aaacaaaggaccaagagaaccagaaaccctttcagcagctgtagtgtaccctaa

DBGET integrated database retrieval system