KEGG   Mus musculus (house mouse): 19337
Entry
19337             CDS       T01002                                 
Symbol
Rab33a, Rabs10
Name
(RefSeq) RAB33A, member RAS oncogene family
  KO
K07919  Ras-related protein Rab-33A
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19337 (Rab33a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19337 (Rab33a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab GTPases
    19337 (Rab33a)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    19337 (Rab33a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab33
    19337 (Rab33a)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 SRPRB GTP_EFTU G-alpha PduV-EutP TniB FeoB_N
Other DBs
NCBI-GeneID: 19337
NCBI-ProteinID: NP_035358
MGI: 109493
Ensembl: ENSMUSG00000031104
UniProt: P97950 Q3SXA7
Position
X:47602540..47619117
AA seq 237 aa
MAQPILGHGSLQPASAAGLASLELDSSMDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGT
FPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVT
KMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFET
SAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFSQEANGKASCPC
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcacagcccatcctgggccatgggagcctgcagcccgcctcagctgctggcttggca
tccttggagctcgactcatcgatggaccagtacgtgcagattcgcattttcaaaatcatc
gtgattggggattccaacgtgggcaagacctgcctgaccttccgcttctgcgggggtact
ttcccagacaagactgaggccactatcggtgtggacttcagggagaagaccgtggaaatc
gagggcgagaagatcaaggttcaggtgtgggacacggcaggccaagaacgcttccgtaaa
agcatggttgagcattactaccgcaacgtgcatgccgtggtctttgtctatgacgtcacc
aagatgacctccttcaccaacttaaaaatgtggatccaggaatgcaacgggcatgctgtg
cccccactcgtccccaaggtgcttgtgggtaacaagtgtgacttgagggaacagatccag
gtaccctccaacttagccctgaaatttgctgacgctcataacatgctcttgtttgagaca
tcagccaaggaccccaaagaaagccagaatgtggagtcgatcttcatgtgcctggcttgc
cgacttaaggcccagaaatccctcttgtaccgtgatgccgagaggcagcaaggcaaggtg
cagaaactggagttctcacaagaggctaacggtaaagcctcctgtccttgttga

DBGET integrated database retrieval system