KEGG   Mus musculus (house mouse): 19338
Entry
19338             CDS       T01002                                 
Symbol
Rab33b
Name
(RefSeq) RAB33B, member RAS oncogene family
  KO
K07920  Ras-related protein Rab-33B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    19338 (Rab33b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19338 (Rab33b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19338 (Rab33b)
   04031 GTP-binding proteins [BR:mmu04031]
    19338 (Rab33b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab GTPases
    19338 (Rab33b)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    19338 (Rab33b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   19338 (Rab33b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab33
    19338 (Rab33b)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA G-alpha SRPRB TniB PduV-EutP AAA_24
Other DBs
NCBI-GeneID: 19338
NCBI-ProteinID: NP_058554
MGI: 1330805
Ensembl: ENSMUSG00000027739
UniProt: O35963 Q0PD21
Structure
Position
3:51391387..51403649
AA seq 229 aa
MTSEMESSLEVSFSSSCAVSGASGCLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPD
RTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMA
SFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAK
NPNDNDHVEAIFMTLAHKLKSHKPLMLSQLPDNRISLKPETKPAVTCWC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacttcggagatggagtcgtcgctggaggtcagcttctcgtccagctgtgcggtgtca
ggggcgtctgggtgtttgcctcccgcccgctcccgcatcttcaagatcatagtgatcggc
gactcgaacgtgggcaagacgtgcctgacttaccgcttctgcgccggccgcttccccgac
cgcaccgaggccacgatcggggtggacttccgagagcgagccgtggatattgatggagag
cgcatcaagatccagttgtgggacacggcagggcaggagcggttcaggaagagcatggtc
cagcactactacaggaatgtgcatgctgtcgtctttgtgtatgacatgaccaacatggcc
agcttccacagcctgccggcttggatagaggaatgcaaacagcacttgctggcgaacgac
atacctcgaattctggtgggaaataaatgtgacttgagaagcgccattcaggtgcccaca
gacttggcacagaagtttgctgacacacacagtatgcctttgtttgagacctctgctaaa
aaccccaatgataatgaccacgtagaagctatattcatgaccttagctcataagctaaag
agccacaagccattgatgcttagccagctgcctgataacagaattagcctgaaacctgag
accaagcctgcggtgacttgctggtgctga

DBGET integrated database retrieval system