KEGG   Mus musculus (mouse): 19344
Entry
19344             CDS       T01002                                 

Gene name
Rab5b, C030027M18Rik
Definition
(RefSeq) RAB5B, member RAS oncogene family
  KO
K07888  Ras-related protein Rab-5B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
mmu05146  Amoebiasis
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19344 (Rab5b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19344 (Rab5b)
   04145 Phagosome
    19344 (Rab5b)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    19344 (Rab5b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19344 (Rab5b)
   05152 Tuberculosis
    19344 (Rab5b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    19344 (Rab5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19344 (Rab5b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19344 (Rab5b)
   04031 GTP-binding proteins [BR:mmu04031]
    19344 (Rab5b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    19344 (Rab5b)
 Endosome - Lysosome transport
    19344 (Rab5b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19344 (Rab5b)
  Exosomal proteins of other body fluids (saliva and urine)
   19344 (Rab5b)
  Exosomal proteins of colorectal cancer cells
   19344 (Rab5b)
  Exosomal proteins of melanoma cells
   19344 (Rab5b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    19344 (Rab5b)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 19344
NCBI-ProteinID: NP_803130
MGI: 105938
Ensembl: ENSMUSG00000000711
UniProt: P61021 B2RPS1
Position
10; 10 D3
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagtacagccaggcccaatgggcaaccccaggccagcaaaatatgccag
ttcaaattggtcctgctgggagagtctgcagtggggaagtctagcctggtgttacgtttt
gtcaaaggacagttccatgaataccaggaaagcaccattggagcggccttcctcacccaa
tccgtgtgtttagatgacacaacagtcaagtttgagatctgggacactgctgggcaggag
cgataccacagtttagcccctatgtactacaggggtgcccaggctgcaatcgtggtctat
gatattactaatcaggaaacgtttgctcgggcaaagacatgggtaaaggaactacagcgg
caagccagccctagcattgttattgccttggcagggaacaaagctgaccttgccaacaag
cgcatggtggagtatgaagaggctcaggcatatgcagatgacaacagcttattatttatg
gagacttcagctaagactgctatgaacgtgaatgatctcttcctggcaatagcaaagaag
ttgccaaagagcgaaccccagaatctggggggtgcggcaggccgaagtcggggtgtggat
cttcatgagcagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Mus musculus (mouse): 19345
Entry
19345             CDS       T01002                                 

Gene name
Rab5c, AI326010, Rabl
Definition
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
mmu05146  Amoebiasis
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19345 (Rab5c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19345 (Rab5c)
   04145 Phagosome
    19345 (Rab5c)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    19345 (Rab5c)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19345 (Rab5c)
   05152 Tuberculosis
    19345 (Rab5c)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    19345 (Rab5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19345 (Rab5c)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19345 (Rab5c)
   04031 GTP-binding proteins [BR:mmu04031]
    19345 (Rab5c)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    19345 (Rab5c)
 Endosome - Lysosome transport
    19345 (Rab5c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19345 (Rab5c)
  Exosomal proteins of other body fluids (saliva and urine)
   19345 (Rab5c)
  Exosomal proteins of colorectal cancer cells
   19345 (Rab5c)
  Exosomal proteins of bladder cancer cells
   19345 (Rab5c)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    19345 (Rab5c)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 19345
NCBI-ProteinID: NP_077776
MGI: 105306
Ensembl: ENSMUSG00000019173
Vega: OTTMUSG00000002056
UniProt: P35278 Q3TJ39
Structure
PDB: 
1HUQ 1Z07 1Z0D

Position
11 D; 11 63.54 cM
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcgaggaggtgcagcacgacccaatggaccagctgctggcaacaagatctgt
cagtttaagctggtcctcttgggcgagtctgccgtgggcaagtccagcctggtcctccgc
tttgtcaaggggcagttccatgagtaccaggagagcacaattggagcggctttcctcaca
cagactgtctgcttagacgatacaacggtcaagtttgagatctgggacacagctggccaa
gagcgctatcacagcctggccccgatgtactatcggggggcccaagcagccattgtggtc
tatgacatcaccaacacagatacatttgcacgggctaagaattgggtgaaggagttacag
aggcaggccagccccaacatcgtcattgcactagcggggaacaaagcagacctggccagc
aagagagctgtggagtttcaggaagcacaagcctatgcagatgacaacagcttgctcttc
atggagacgtctgccaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag
aagcttcccaagaatgagccccagaatgcggctggggctccgggccgaaccagaggtgtg
gatctgcaggagagcaacccagccagccggagccagtgctgcagcaactga

KEGG   Mus musculus (mouse): 271457
Entry
271457            CDS       T01002                                 

Gene name
Rab5a, 2410015H04Rik, AI663973, AU021172, nnyRab5a
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05146  Amoebiasis
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    271457 (Rab5a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    271457 (Rab5a)
   04145 Phagosome
    271457 (Rab5a)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    271457 (Rab5a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    271457 (Rab5a)
   05152 Tuberculosis
    271457 (Rab5a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    271457 (Rab5a)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    271457 (Rab5a)
   05022 Pathways of neurodegeneration - multiple diseases
    271457 (Rab5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    271457 (Rab5a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    271457 (Rab5a)
   04031 GTP-binding proteins [BR:mmu04031]
    271457 (Rab5a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    271457 (Rab5a)
 Endosome - Lysosome transport
    271457 (Rab5a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   271457 (Rab5a)
  Exosomal proteins of other body fluids (saliva and urine)
   271457 (Rab5a)
  Exosomal proteins of colorectal cancer cells
   271457 (Rab5a)
  Exosomal proteins of bladder cancer cells
   271457 (Rab5a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    271457 (Rab5a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 271457
NCBI-ProteinID: NP_080163
MGI: 105926
Ensembl: ENSMUSG00000017831
UniProt: Q9CQD1
Position
17 C; 17 27.82 cM
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactggtccttctaggagagtctgctgttggcaaatcaagcctggttcttcgcttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcctttctaacccaa
actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggtcaagaa
cggtatcatagcttagcaccaatgtactaccgaggagcacaagcagccatagttgtgtat
gatatcacaaatgaggaatcctttgcgagagcaaaaaactgggttaaagaacttcaaagg
caagcaagtcctaatattgtgatagctttgtcaggaaacaaagctgacttagcaaataaa
agagctgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg
gagacatcagctaagacatcaatgaatgtaaatgaaatatttatggcaatagctaaaaag
ctgccaaagaatgaaccacagaatcctggtgcaaactcagccagaggacgaggagtagac
cttactgagcctgcacagccagccagaagccagtgttgtagtaactga

DBGET integrated database retrieval system