KEGG   Mus musculus (house mouse): 19345
Entry
19345             CDS       T01002                                 
Symbol
Rab5c, AI326010, Rabl
Name
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
mmu05146  Amoebiasis
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19345 (Rab5c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19345 (Rab5c)
   04145 Phagosome
    19345 (Rab5c)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    19345 (Rab5c)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19345 (Rab5c)
   05152 Tuberculosis
    19345 (Rab5c)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    19345 (Rab5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19345 (Rab5c)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19345 (Rab5c)
   04031 GTP-binding proteins [BR:mmu04031]
    19345 (Rab5c)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    19345 (Rab5c)
 Endosome - Lysosome transport
    19345 (Rab5c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19345 (Rab5c)
  Exosomal proteins of other body fluids (saliva and urine)
   19345 (Rab5c)
  Exosomal proteins of colorectal cancer cells
   19345 (Rab5c)
  Exosomal proteins of bladder cancer cells
   19345 (Rab5c)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    19345 (Rab5c)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 19345
NCBI-ProteinID: NP_077776
MGI: 105306
Ensembl: ENSMUSG00000019173
UniProt: P35278 Q3TJ39
Structure
Position
11:complement(100605829..100629041)
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcgaggaggtgcagcacgacccaatggaccagctgctggcaacaagatctgt
cagtttaagctggtcctcttgggcgagtctgccgtgggcaagtccagcctggtcctccgc
tttgtcaaggggcagttccatgagtaccaggagagcacaattggagcggctttcctcaca
cagactgtctgcttagacgatacaacggtcaagtttgagatctgggacacagctggccaa
gagcgctatcacagcctggccccgatgtactatcggggggcccaagcagccattgtggtc
tatgacatcaccaacacagatacatttgcacgggctaagaattgggtgaaggagttacag
aggcaggccagccccaacatcgtcattgcactagcggggaacaaagcagacctggccagc
aagagagctgtggagtttcaggaagcacaagcctatgcagatgacaacagcttgctcttc
atggagacgtctgccaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag
aagcttcccaagaatgagccccagaatgcggctggggctccgggccgaaccagaggtgtg
gatctgcaggagagcaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system