KEGG   Mus musculus (mouse): 193452
Entry
193452            CDS       T01002                                 

Gene name
Zfp184, 4930500C15Rik
Definition
(RefSeq) zinc finger protein 184 (Kruppel-like)
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    193452 (Zfp184)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    193452 (Zfp184)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    193452 (Zfp184)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_11 zf_UBZ zinc_ribbon_15 zf-C2H2_jaz zf-C2HC_2 zf-H2C2_5
Other DBs
NCBI-GeneID: 193452
NCBI-ProteinID: NP_898835
MGI: 1922244
Ensembl: ENSMUSG00000006720
Vega: OTTMUSG00000000453
UniProt: Q7TSH9 Q5SZM8
Position
13; 13 A3.1
AA seq 737 aa
MAGLSFADSASLHEGRPLLLPSSFRESVTFKDVVVNFTQEEWKHLDPIQRDLFRDVTLEN
YTHLVSIGLQVSKPDMISQLEQGTEPWTEDSCIPVGPLEDWKKRAGNSVSSLELDISEEH
LFSETVVTNSKRDDGSLEKLQANQQMLPREVQITEKTAPTCESNLSVSSSFITQTEVALD
QPSTKTRAKQNSHPVKKEKLCKCNECGKAFTYCSALIRHQRTHTGEKPYKCNECNKAFSR
SENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIHTGEKPYKCDECGKAFSQRTHL
VQHQRIHTGEKPYTCTECGKSFSQRGHFMEHQKIHTGEKPFKCEECEKTFTRSTHLTQHQ
KIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHT
GEKPYDCAECGKAFSYWSSLAQHLKIHTGEKPYKCSDCGKAFSYCSSLTQHRRIHTREKP
FECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCH
ECGKTFSYGSSLIQHKKIHTGERPYKCNECGRAFNQKIHLTQHKRIHTGAKPYACPKCGK
TFRHCSSLAQHQKTHTEEKPYQCNKCEKTFSQNSRLTQHQRIHTGEKPYKCSECDKCFTG
SVHLTEHRSTHTGEKPYNSECPQTFSQSTYLTQHQKIHSGEKLLGCEDCEKAFQCHSALT
KHQRLHPAVAAVGTSLT
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggcaggtctgtcctttgcagactctgccagtctccacgagggacgtcccctactccta
ccatctagttttcgggaatcagtgaccttcaaggatgtggtcgtgaacttcactcaggaa
gaatggaaacacctggatcctatacagagagatttgttcagagatgtgacactggaaaat
tatacacatctggtctctatagggctccaggtttccaaacctgatatgatttcccaacta
gagcaagggacagagccatggactgaggattcgtgcattcctgtcggtcccttggaagac
tggaagaaaagagctggaaatagtgtgtcatccctagaacttgacatttctgaagagcat
ctattctcagagacagtagtaaccaacagcaaaagggatgatgggagtttagagaagctt
caagcaaaccaacagatgctgccaagggaagtccaaataacggagaaaacagcacccact
tgtgagagcaacctcagtgtgagctcaagcttcataacacaaacggaagtagctctcgat
cagccttccactaaaacaagagccaagcagaattcccacccagttaaaaaggagaagctg
tgtaagtgcaacgaatgtggtaaagcttttacttactgttctgctctcattcgccaccaa
agaacgcatactggagagaaaccctataaatgtaatgaatgtaacaaagctttcagcaga
agtgaaaaccttataaaccatcagagaatccatacgggagataaaccgtacaaatgtgac
cagtgtggaaagggtttcattgagggtccatctctcactcaacatcaaagaattcacact
ggagaaaagccctataaatgtgatgaatgtgggaaggcctttagtcagaggacccatctt
gttcagcatcagagaattcacactggtgagaagccatatacttgtaccgagtgtgggaaa
tccttcagccagagaggtcactttatggagcaccagaaaattcatacaggagaaaaacct
ttcaagtgtgaggagtgtgagaaaaccttcaccaggagcacacacctcactcaacatcag
aaaattcacactggggagaaaacttacaagtgtaatgaatgtgggaaggccttcaacggc
ccatcaacgtttatccgtcaccatatgattcatactggagaaaagccttatgagtgtaat
gaatgtggcaaagccttcagccagcactccaacctgactcagcatcagaaaacacacact
ggggagaaaccctatgactgtgcagaatgtgggaaagcctttagttactggtcatcccta
gctcagcacctgaaaattcatacaggagagaagccctacaagtgtagcgactgcgggaag
gccttcagttactgctcctcccttactcagcatcggaggattcacacccgagagaagccc
tttgagtgcagtgagtgtggaaaggctttcagctatctgtcaaaccttaatcagcatcag
aaaactcacacccaggagaaagcctatgaatgtaaggaatgtgggaaagcctttattcgg
agttcatctcttgctaagcatgaaagaattcatactggagagaagccttatcaatgtcat
gaatgtggaaaaaccttcagctatggctcatctcttattcagcataagaaaatccatact
ggtgaaagaccttacaagtgtaatgaatgtgggcgagccttcaaccagaaaatacacctt
acacaacacaagagaattcatacaggagcaaagccgtatgcctgccccaagtgcgggaag
acctttcgacactgttcatctcttgctcaacatcaaaaaactcacacagaagaaaaaccc
taccagtgtaacaaatgtgaaaaaaccttcagccagaactcccgtctgactcagcatcag
cgaattcatacgggagagaagccttataagtgcagtgaatgtgacaaatgctttaccggg
agcgtgcacctgactgaacatcggagtactcacactggagagaaaccttacaactctgag
tgcccacagactttcagccagagcacatacctcactcagcatcagaagattcattcagga
gagaagcttttggggtgtgaggactgtgaaaaagccttccagtgtcactctgctctcacc
aaacaccagagattgcaccctgctgtggctgctgtaggaacatcattaacatag

DBGET integrated database retrieval system