KEGG   Mus musculus (mouse): 19352
Entry
19352             CDS       T01002                                 

Symbol
Rabggtb
Name
(RefSeq) Rab geranylgeranyl transferase, b subunit
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mmu01006]
    19352 (Rabggtb)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19352 (Rabggtb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     19352 (Rabggtb)
Prenyltransferases [BR:mmu01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   19352 (Rabggtb)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    19352 (Rabggtb)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    19352 (Rabggtb)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-GeneID: 19352
NCBI-ProteinID: NP_035361
MGI: 99537
Ensembl: ENSMUSG00000038975
Vega: OTTMUSG00000052933
UniProt: P53612 Q3TVF4
Position
3 H3; 3 78.76 cM
AA seq 339 aa
MGSLLFSWKGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYW
GLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVH
VINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVL
SCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGR
PEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTL
FGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgggatctctgcttttttcttggaagggcacacagcagaaagacgttactatcaagtca
gatgcgcctgacaccctgttgctggagaagcatgccgattatattgcttcctatggctca
aagaaagatgattatgaatactgcatgtctgaatacctgagaatgagcggcgtctattgg
ggcctgactgtgatggacctcatgggacagcttcatcgcatgaaccgagaagaaatcctg
gtgtttatcaagtcgtgccagcatgagtgtgggggaataagtgctagcattgggcacgac
ccccaccttctgtacacgctcagtgctgtccagattcttactctgtatgacagtgttcat
gttatcaacgtagataaggtcgtggcctatgttcagagcctacagaaagaagatggctcc
tttgctggagacatttggggagaaattgatacaagattctcattttgtgcggtggcaact
ttggctcttttgggcaagcttgatgctattaatgtggaaaaggcgattgagtttgttttg
tcctgcatgaactttgatggtggatttgggtgcagaccaggctctgaatctcacgctggg
cagatctattgttgcacaggattcctggccataactagtcagttgcaccaagtgaactcc
gacctacttggttggtggctttgtgagcggcagttgccctcaggcggactcaatggaaga
cccgagaagttaccagatgtgtgctattcatggtgggtgttggcctccctaaagatcatc
gggagacttcattggattgacagagaaaagcttcgaagtttcatcttagcgtgtcaagat
gaagagacgggaggatttgcagacagaccaggagatatggtggatccctttcatacctta
tttggcattgctgggttgtcacttctgggagaagagcagatcaagcctgttagccctgtc
ttctgtatgccagaagaggtgcttcagagggtgaatgtccagcctgagctagtgagctag

DBGET integrated database retrieval system