KEGG   Mus musculus (mouse): 19354
Entry
19354             CDS       T01002                                 

Gene name
Rac2, AI323801, AI452260
Definition
(RefSeq) Rac family small GTPase 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05020  Prion disease
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05415  Diabetic cardiomyopathy
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19354 (Rac2)
   04014 Ras signaling pathway
    19354 (Rac2)
   04015 Rap1 signaling pathway
    19354 (Rac2)
   04310 Wnt signaling pathway
    19354 (Rac2)
   04370 VEGF signaling pathway
    19354 (Rac2)
   04071 Sphingolipid signaling pathway
    19354 (Rac2)
   04024 cAMP signaling pathway
    19354 (Rac2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19354 (Rac2)
   04520 Adherens junction
    19354 (Rac2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19354 (Rac2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    19354 (Rac2)
   04650 Natural killer cell mediated cytotoxicity
    19354 (Rac2)
   04662 B cell receptor signaling pathway
    19354 (Rac2)
   04664 Fc epsilon RI signaling pathway
    19354 (Rac2)
   04666 Fc gamma R-mediated phagocytosis
    19354 (Rac2)
   04670 Leukocyte transendothelial migration
    19354 (Rac2)
   04062 Chemokine signaling pathway
    19354 (Rac2)
  09158 Development and regeneration
   04360 Axon guidance
    19354 (Rac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19354 (Rac2)
   05231 Choline metabolism in cancer
    19354 (Rac2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    19354 (Rac2)
   05212 Pancreatic cancer
    19354 (Rac2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19354 (Rac2)
   05163 Human cytomegalovirus infection
    19354 (Rac2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    19354 (Rac2)
  09164 Neurodegenerative disease
   05020 Prion disease
    19354 (Rac2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    19354 (Rac2)
   05415 Diabetic cardiomyopathy
    19354 (Rac2)
   05416 Viral myocarditis
    19354 (Rac2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19354 (Rac2)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    19354 (Rac2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 19354
NCBI-ProteinID: NP_033034
MGI: 97846
Ensembl: ENSMUSG00000033220
UniProt: Q05144
Position
15; 15 E1
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRPCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggtgatggagccgtgggcaagacgtgtcttctc
atcagctacaccaccaacgccttccctggagaatacatccccactgtatttgacaactac
tcagccaatgtgatggtggacagtaagccggtgaacctggggctgtgggataccgcaggt
caggaggactatgaccgcctccggccactctcctacccacagacagatgtatttctcatc
tgcttctcgctagtcagcccagcctcctatgagaatgtccgtgccaagtggttccctgag
gtacggcaccactgccccagcacccccatcatcctggtgggtaccaagctggaccttcgc
gatgacaaggacaccatcgagaagctgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggatattgattcagtcaagtacttggaatgttctgcactc
acccagcgaggcctgaagaccgtcttcgatgaggcaatccgcgcagtcctctgcccacag
cccacacgacagcagaagcgcccctgcagcctgctctag

DBGET integrated database retrieval system