KEGG   Mus musculus (mouse): 19364Help
Entry
19364             CDS       T01002                                 

Gene name
Rad51d, R51H3, Rad51l3, TRAD, Trad-d5
Definition
(RefSeq) RAD51 paralog D
  KO
K10871  RAD51-like protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    19364 (Rad51d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19364 (Rad51d)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     19364 (Rad51d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 DnaB_C ATPase RecA HHH_5 AAA_24 AAA_22 AAA_19 AAA_5 CobU AAA CbiA DUF2075 ABC_tran GvpD ATPase_2 IstB_IS21 AAA_18 AAA_11 CbiG_N PAXNEB
Motif
Other DBs
NCBI-GeneID: 19364
NCBI-ProteinID: NP_035365
MGI: 1261809
Ensembl: ENSMUSG00000018841
Vega: OTTMUSG00000000932
UniProt: O55230 Q3UGT8
Position
11 C; 11 50.3 cM
AA seq 329 aa AA seqDB search
MGMLRAGLCPGLTEETVQLLRGRKIKTVADLAAADLEEVAQKCGLSYKALVALRRVLLAQ
FSAFPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCV
AANVAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASALQRIQVVRSFDIFRMLD
MLQDLRGTIAQQEATSSGAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARD
LGVAVVVTNHLTRDWDGRRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSP
RQPTGLQEMIDIGTLGTEEQSPELPGKQT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgctcagggcagggctgtgcccgggcctcaccgaggagaccgtccagcttctc
agaggccgaaagataaaaacagtggcagacctggcagctgctgacttggaggaagtagcc
cagaagtgtggcttgtcctacaaggccctcgttgccctgaggagggtgttgctggcgcag
ttctcggctttccccttaaatggcgcagatctctatgaggaactgaagacttccacggcc
atcctgtccaccggcatcggaagcctggacaaactacttgatgctggcctctatactggg
gaggtgactgaaattgtgggtggcccaggtagcggcaaaacccaggtgtgtctctgtgtg
gctgcaaatgtggcccatagcctgcagcagaatgtactgtatgtggattccaatggagga
atgacggcgtcccgcctcctccagctactacaggctagaacccaagatgaggagaaacag
gcaagtgctctccagaggatacaggtggtgcgttcatttgacatcttccggatgctagat
atgctacaggaccttcgcggcaccatagcccagcaggaagcaacttcttcaggcgccgtg
aaggttgtgattgtggactcggtcactgcagtggtcgccccacttctgggaggtcagcag
agggaaggcctggccttgatgatgcagctggcccgagagctcaagatcctggcccgggac
ctgggtgtggcagtggtggtgaccaaccacttgactcgagattgggatggtagaagattc
aaacctgcccttggacgctcctggagctttgtgcccagtacccggattctcctggatgtc
actgagggggctgggacactcggtagcagccaacgcacagtatgtctgaccaagtctccc
cgccagccaacgggtctgcaggagatgatagacattgggacattggggactgaggagcag
agcccagaattacctggcaagcagacgtga

DBGET integrated database retrieval system