KEGG   Mus musculus (mouse): 19368
Entry
19368             CDS       T01002                                 

Gene name
Raet1a, RAE-, RAE-1alpha, Rae, Rae1a, Rae1alpha, Raet1
Definition
(RefSeq) retinoic acid early transcript 1, alpha
  KO
K07987  retinoic acid early transcript 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    19368 (Raet1a)
SSDB
Motif
Pfam: MHC_I_2 MHC_I
Other DBs
NCBI-GeneID: 19368
NCBI-ProteinID: NP_033042
MGI: 109477
UniProt: O08602
Position
10; 10 A3
AA seq 253 aa
MAKAAVTKRHHFMIQKLLILLSYGYTNGLDDAHSLRCNLTIKDPTPADPLWYEAKCLVDE
ILILHLSNINKTMTSGDPGETANATEVGECLTQPLKDLCQKLRNKVSNTKVDTHKTNGYP
HLQVTMIYLQSQGQIPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFV
KRLKFLIPECRQEVDEFLKQPKEKPRSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGL
IFISLLFAFAFAM
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccaaggcagcagtgaccaagcgccatcattttatgattcagaagctgttaattcta
ctgagctatggatacaccaacgggctggatgatgcacactctcttaggtgcaacttgacc
atcaaggatcctaccccagcagatcctctctggtatgaagcgaagtgcttagtggatgaa
atacttatcctccatttaagtaacataaacaagaccatgacttcaggtgacccaggggag
acagcaaatgccactgaagtgggggaatgtttgacacaacctctgaaagatttgtgccag
aagttgaggaacaaggtgtctaacaccaaagtggacactcacaagaccaatggttaccca
catttacaagtcaccatgatttatctgcaaagccagggccaaattcctagtgccacctgg
gaattcaacatcagtgacagttacttcttcaccttctacacagagaatatgagctggaga
tcagctaatgatgaatcaggggttatcatgaataaatggaaagatgatggggaatttgtg
aaacgattgaaattcttgatacccgaatgcagacaggaagttgatgaattcttaaagcag
cccaaggaaaagccaagatcaacctcaaggtcccccagtatcacccagcttacatcaact
tccccgcttccacctcccagccactctacttctaagaaaggatttatctctgtgggactc
atcttcatatctttattatttgcatttgcatttgcaatgtga

KEGG   Mus musculus (mouse): 19369
Entry
19369             CDS       T01002                                 

Gene name
Raet1b, RAE-1b, RAE-1beta, Rae1b
Definition
(RefSeq) retinoic acid early transcript beta
  KO
K07987  retinoic acid early transcript 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    19369 (Raet1b)
SSDB
Motif
Pfam: MHC_I_2 MHC_I
Other DBs
NCBI-GeneID: 19369
NCBI-ProteinID: NP_033043
MGI: 109432
UniProt: O08603
Structure
PDB: 
4PP8 1JFM

Position
10
AA seq 253 aa
MAKAAVTKRHHFMIQKLLILLSYGYTNGLDDAHSLRCNLTIKDPTPADPLWYEAKCFVGE
ILILHLSNINKTMTSGDPGETANATEVKKCLTQPLKNLCQKLRNKVSNTKVDTHKTNGYP
HLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFV
KQLKFLIHECSQKMDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGL
IFISLLFAFAFAM
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccaaggcagcagtgaccaagcgccatcattttatgattcagaagctgttaattcta
ctgagctatggatacaccaacgggctggatgatgcacactctcttaggtgcaacttgacc
atcaaggatcctaccccagcagatcctctctggtatgaagcgaagtgcttcgtgggtgaa
atacttatcctccatttaagtaacataaacaagaccatgacttcaggtgacccaggggag
acagcaaatgccactgaagtgaagaaatgtttgacacaacctctgaaaaatttgtgccag
aagttgaggaacaaggtgtctaacaccaaagtggacactcacaagaccaatggttaccca
catttacaagtcaccatgatttatccgcaaagccagggccgaactcctagtgccacctgg
gaattcaacatcagtgacagttacttcttcaccttctacacagagaatatgagctggaga
tcagctaatgatgaatcaggggttatcatgaataaatggaaagatgatggggaatttgtg
aaacaattgaaattcttgatacacgaatgcagtcagaaaatggatgaattcttaaagcag
tccaaggaaaagccaagatcaacctcaaggtcccccagtatcacccagcttacatcaact
tccccgcttccacctcccagccactctacttctaagaaaggatttatctctgtgggactc
atcttcatatctttattatttgcatttgcatttgcgatgtga

KEGG   Mus musculus (mouse): 19370
Entry
19370             CDS       T01002                                 

Gene name
Raet1c, RAE-1g, RAE-1gamma, Rae1c
Definition
(RefSeq) retinoic acid early transcript gamma
  KO
K07987  retinoic acid early transcript 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    19370 (Raet1c)
SSDB
Motif
Pfam: MHC_I_2 MHC_I
Other DBs
NCBI-GeneID: 19370
NCBI-ProteinID: NP_033044
MGI: 109431
UniProt: O08604
Structure
PDB: 
4G59

Position
10; 10 A3
AA seq 253 aa
MAKAAVTKRHHFMIQKLLILLSYGYTNGLDDAHSLRCNLTIKAPTPADPLWYEAKCLVDE
ILILHLSNINKTMTSGDPGETANATEVGECLTQPVNDLCQKLRDKVSNTKVDTHKTNGYP
HLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWNDDGDLV
QRLKYFIPECRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGL
IFISLLFAFAFAM
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccaaggcagcagtgaccaagcgccatcattttatgattcagaagctgttaattcta
ctgagctatggatacaccaacgggctggatgatgcacactctcttaggtgcaacttgacc
atcaaggctcctaccccagcagatcctctctggtatgaagcgaagtgcttagtggatgaa
atacttatcctccatttaagtaacataaacaagaccatgacttcaggtgacccaggggag
acggcaaatgccactgaagtgggggaatgtttgacacaacctgtgaacgatttgtgccag
aagttgagggacaaggtgtctaacaccaaagtggacactcacaagaccaatggttaccca
catttacaagtcaccatgatttatccgcaaagccagggccaaactcctagtgccacctgg
gaattcaacatcagtgacagttacttcttcaccttctacacagagaatatgagctggaga
tcagctaatgatgaatcaggggttatcatgaataaatggaacgatgatggggaccttgtg
caacgattgaaatacttcatacccgaatgcagacagaaaattgatgaattcttaaagcag
tccaaggaaaagccaagatcaacctcaaggtcccccagtatcacccagcttacatcaact
tccccacttccacctcccagccactctacttctaagaaaggatttatctctgtgggactc
atcttcatatctttattatttgcatttgcatttgcgatgtga

KEGG   Mus musculus (mouse): 379043
Entry
379043            CDS       T01002                                 

Gene name
Raet1e
Definition
(RefSeq) retinoic acid early transcript 1E
  KO
K07987  retinoic acid early transcript 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    379043 (Raet1e)
SSDB
Motif
Pfam: MHC_I_2 MHC_I
Other DBs
NCBI-GeneID: 379043
NCBI-ProteinID: NP_937836
MGI: 2675273
Ensembl: ENSMUSG00000053219
Vega: OTTMUSG00000042696
UniProt: Q9CZQ6 D7F2B6
Position
10; 10 A3
AA seq 251 aa
MAKAAVTKRHHFMIQKLLILLSYGYTNGLDDAHSLRCNLTIKDPTSADLPWCDVKCSVDE
ITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHL
QVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQ
LKYFIPQCRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGLIF
ISLLFAFAFAM
NT seq 756 nt   +upstreamnt  +downstreamnt
atggccaaggcagcagtgaccaagcgccatcattttatgattcagaagctgttaattcta
ctgagctatggatacaccaacgggctggatgatgcacactctcttaggtgcaacttgacc
atcaaggatcctacctcagcagaccttccctggtgtgacgtgaagtgctcagtggatgaa
ataactatcctccatttaaataacataaacaagaccatgacttcaggtgacccagggaag
atggcaaatgccactggcaaatgtttgacacaacctctgaacgatttgtgccaggagttg
agggacaaggtgtctaacaccaaagtggacactcacaagaccaatggttacccacattta
caagtcaccatgatttatccgcaaagccagggccaaactcctagtgccacctgggaattc
aacatcagtgacagttacttcttcaccttctacacagagaatatgagctggagatcagct
aatgatgaatcaggggttatcatgaataaatggaaagatgatggggaccttgtgcaacaa
ttgaaatacttcataccccaatgcagacagaaaattgatgaattcttaaagcagtccaag
gaaaagccaagatcaacctcaaggtcccccagtatcacccagcttacatcaacttccccg
cttccacctcccagccactctacttctaagaaaggatttatctctgtgggactcatcttc
atatctttattatttgcatttgcatttgcgatgtga

KEGG   Mus musculus (mouse): 56554
Entry
56554             CDS       T01002                                 

Gene name
Raet1d, RAE-1d, RAE-1delta
Definition
(RefSeq) retinoic acid early transcript delta
  KO
K07987  retinoic acid early transcript 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    56554 (Raet1d)
SSDB
Motif
Pfam: MHC_I_2 MHC_I DUF2956
Other DBs
NCBI-GeneID: 56554
NCBI-ProteinID: NP_064414
MGI: 1861032
Ensembl: ENSMUSG00000078452
Vega: OTTMUSG00000033466
UniProt: Q9JI58
Position
10; 10 A3
AA seq 249 aa
MAKAAVTKRHHFMIQKLLILLSYGYTNGLDDAHSLRCNLTIKAPTPADEVKCFVGEILIL
HLSNINKTMTSGDPGETANATEVGECLTQPLKDLCQKLRDKVSNTKVDTHKTNGYPHLQV
TMIYPQSQGQTPSATWEFNISDSYFFTFYTEIMSWRSANDESGVIMNKWKDDGEFVKQLK
FLIHGCSQKMDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPTSHSTSKKGFISVGLIFIS
LLFAFAFAM
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccaaggcagcagtgaccaagcgccatcattttatgattcagaagctgttaattcta
ctgagctatggatacaccaacgggctagatgatgcacactctcttaggtgcaacttgacc
atcaaggctcctaccccagcagatgaagtgaagtgcttcgtgggtgaaatacttatcctc
catttaagtaacataaacaagaccatgacttcaggtgacccaggggagacagcaaatgcc
actgaagtgggggaatgtttaacacaacctctgaaagatttgtgccagaagttgagggac
aaggtgtctaacaccaaagtggacactcacaagaccaatggttacccacatttacaagtc
accatgatttatccgcaaagccagggccaaactcctagtgccacctgggaattcaacatc
agtgacagttacttcttcaccttctacacagagattatgagctggagatcagctaatgat
gaatcaggggttatcatgaataaatggaaagatgatggggaatttgtgaaacaattgaaa
ttcttgatacacggatgcagtcagaaaatggatgaattcttaaagcagtccaaggaaaag
ccaagatcaacctcaaggtcccccagtatcacccagcttacatcaacttccccgcttcca
cctaccagccactctacttctaagaaaggatttatctctgtgggactcatcttcatatct
ttattatttgcatttgcatttgcaatgtga

DBGET integrated database retrieval system