KEGG   Mus musculus (mouse): 19373
Entry
19373             CDS       T01002                                 

Symbol
Rag1, Rag-1
Name
(RefSeq) recombination activating 1
  KO
K10628  V(D)J recombination-activating protein 1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    19373 (Rag1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    19373 (Rag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    19373 (Rag1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     19373 (Rag1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    19373 (Rag1)
SSDB
Motif
Pfam: RAG1 RAG1_imp_bd zf-RAG1 zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-RING_2 zf-RING_10
Other DBs
NCBI-GeneID: 19373
NCBI-ProteinID: NP_033045
MGI: 97848
Ensembl: ENSMUSG00000061311
Vega: OTTMUSG00000014584
UniProt: P15919 Q3TR87
Structure
PDB: 

Position
2 E2; 2 53.88 cM
AA seq 1040 aa
MAASLPSTLSFSSAPDEIQHPQIKFSEWKFKLFRVRSFEKAPEEAQKEKDSSEGKPYLEQ
SPVVPEKPGGQNSILTQRALKLHPKFSKKFHADGKSSDKAVHQARLRHFCRICGNRFKSD
GHSRRYPVHGPVDAKTQSLFRKKEKRVTSWPDLIARIFRIDVKADVDSIHPTEFCHDCWS
IMHRKFSSSHSQVYFPRKVTVEWHPHTPSCDICFTAHRGLKRKRHQPNVQLSKKLKTVLN
HARRDRRKRTQARVSSKEVLKKISNCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADP
VETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILNSLMVKCPAQDC
NEEVSLEKYNHHVSSHKESKETLVHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFAD
KEEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQ
YHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSG
LASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCD
GMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLA
DESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFRGTGYDEKLVREVEGLEA
SGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVS
AKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKEERKRWQATLDKHLRKR
MNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAK
ECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEG
NESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKSSGFTMNSKE
TLGDPLGIEDSLESQDSMEF
NT seq 3123 nt   +upstreamnt  +downstreamnt
atggctgcctccttgccgtctaccctgagcttcagttctgcacccgatgaaattcaacac
ccacaaatcaaattttccgagtggaaatttaagctgtttagggtgagatcctttgaaaag
gcacccgaagaagcacagaaggagaaggattcctcagaggggaaaccttacctagaacag
tctccagtagttccagagaagcctggtggtcagaactcaattctgactcaacgagcactg
aaactccatcctaaattttcaaagaaattccatgctgatgggaagtcaagcgacaaagca
gttcaccaagccaggcttagacacttctgccgcatctgtgggaatcgtttcaagagtgac
gggcacagccggagatacccagtccacgggcccgtggacgctaaaacccaaagtcttttc
cgaaagaaggaaaaaagagtcacttcctggccagacctcattgccaggattttccggatc
gacgtgaaggcagatgttgactccatccacccgacggaattctgccatgactgttggagc
atcatgcacagaaagttcagcagttcccacagtcaggtctacttcccaaggaaagtgacc
gtggagtggcacccccacacaccgtcctgtgacatctgttttactgcccatcggggactc
aagaggaagagacatcagcccaatgtgcagctcagcaagaaactaaaaactgtgctcaac
cacgcgagacgggaccgtcgcaagagaactcaggctagggtcagcagcaaggaagtcctg
aagaagatctccaactgcagtaagattcatctcagtaccaagcttcttgccgtggacttc
ccagcacactttgtgaaatccatctcctgccagatatgcgaacacattctggctgatccc
gtggagaccagctgcaagcatctattctgtaggatctgcattctcagatgtctcaaagtc
atgggcagctattgtccctcttgccgatatccgtgcttccctactgacctggagagccca
gtgaagtcctttctgaacatcttgaattctctcatggtcaagtgtcccgcgcaagattgc
aatgaggaagtgagtctggaaaaatataaccaccatgtgtcaagccacaaagaatctaaa
gagactttggtgcatatcaataaagggggacggcctcgccagcatctcctgtcactgacg
agaagggcgcagaaacatcggctgagggagctcaagattcaagtcaaagaatttgctgac
aaagaagaaggtggagatgtgaaggctgtctgcttgacattgtttctcctggcactgagg
gcgaggaatgagcacaggcaagctgatgaattagaggccatcatgcaaggcaggggctcc
gggcttcaaccagctgtttgcttggccatccgtgtcaataccttcctcagctgtagccaa
taccataagatgtacaggactgtgaaagctatcactgggaggcagatttttcaacctttg
catgctcttcggaatgccgagaaagtccttctgccaggctaccatccctttgagtggcag
cccccactgaagaatgtgtcctccagaactgatgttggaattattgatgggctgtctgga
cttgcctcctctgtggatgagtacccagtagataccattgcgaagaggttccgctacgac
tctgctttggtgtctgctttgatggacatggaagaagacatcttggaaggcatgagatcc
caagatcttgatgactacctgaatggtcccttcacagtggtggtaaaggagtcttgcgat
ggaatgggggatgtgagtgagaagcacgggagtgggcccgcagttccagaaaaggccgtt
cgtttctctttcacagtcatgagaattacgatagagcatggttcacagaacgtgaaggtg
tttgaggaacccaagcccaattctgaactgtgttgcaagccgttgtgtcttatgctggca
gatgagtctgaccatgagacccttactgctattctaagccccctcattgccgagagggag
gccatgaagagcagtgaattaacgctggagatgggaggcatccccaggacttttaaattc
atcttcaggggcactggatacgatgaaaaacttgtccgggaagtagaaggcttggaagct
tctggctcagtctacatctgtacactctgtgacaccacccgtttggaagcctctcagaat
cttgtcttccactccataaccagaagccacgccgagaacctgcagcgctatgaggtctgg
cggtccaatccgtatcatgagtccgtggaagagctccgggaccgggtgaaaggggtctct
gccaaacctttcatcgagacagtcccttccatagatgcgcttcactgtgacattggcaat
gcagctgaattctataagattttccagctggagataggggaagtgtataaacatcccaat
gcctctaaagaggaaaggaagagatggcaggccacgctggacaaacatctccggaaaagg
atgaacttaaaaccaatcatgaggatgaatggcaactttgcccggaagcttatgacccaa
gagactgtagacgcagtttgtgagttaattccttctgaggagaggcatgaagctctcagg
gagctcatggacctttacctgaagatgaaacccgtgtggcgctcttcatgtcccgctaaa
gagtgtccagagtccctctgtcagtacagtttcaactcacagcgtttcgcggaactcctc
tccaccaagttcaaatatagatacgagggcaaaatcaccaattactttcacaaaaccttg
gcacatgtccctgaaattattgaaagggatggctctatcggggcctgggcaagtgaggga
aatgaatcgggtaacaagctgtttagacggtttcggaaaatgaatgccaggcagtccaag
tgctatgagatggaagatgtcctgaaacatcactggctgtatacttcaaaatacctccag
aagtttatgaatgctcataacgcgttaaaaagctctgggtttaccatgaactcaaaggag
accttaggggaccctttgggcattgaggactctctggaaagccaagattcaatggagttt
taa

DBGET integrated database retrieval system