KEGG   Mus musculus (mouse): 19374Help
Entry
19374             CDS       T01002                                 

Gene name
Rag2, Rag-2
Definition
(RefSeq) recombination activating gene 2
  KO
K10988  recombination-activating protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    19374 (Rag2)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    19374 (Rag2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAG2 RAG2_PHD Kelch_5 Kelch_3 PHD
Motif
Other DBs
NCBI-GeneID: 19374
NCBI-ProteinID: NP_033046
MGI: 97849
Ensembl: ENSMUSG00000032864
Vega: OTTMUSG00000014585
UniProt: P21784 Q542D1
Structure
PDB: 

Position
2 E2; 2 53.87 cM
AA seq 527 aa AA seqDB search
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPA
IFSKDSCYLPPLRYPATCSYKGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKV
TFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRSYMPSTQRTTEKWNSVADCLP
HVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEIS
EMETPDWTSDIKHSKIWFGSNMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQK
IVSNSQTSTEDPGDSTPFEDSEEFCFSAEATSFDGDDEFDTYNEDDEDDESVTGYWITCC
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNE
HVQIARALQTPKRNPPLQKPPMKSLHKKGSGKVLTPAKKSFLRRLFD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcagatggtaacagtgggtcataacatagccttaattcaaccaggcttctca
cttatgaattttgatggccaagttttcttctttggccagaaaggctggcctaagagatcc
tgtcctactggagtctttcattttgatataaaacaaaatcatctcaaactgaagcctgca
atcttctctaaagattcctgctacctcccacctcttcgttatccagctacttgctcatac
aaaggcagcatagactctgacaagcatcaatatatcattcacggagggaaaacaccaaac
aatgagctttccgataagatttatatcatgtctgtcgcttgcaagaataacaaaaaagtt
actttccgttgcacagagaaagacttagtaggagatgtccctgaacccagatacggccat
tccattgacgtggtgtatagtcgagggaaaagcatgggtgttctctttggaggacgttca
tacatgccttctacccagagaaccacagaaaaatggaatagtgtagctgactgcctaccc
catgttttcttgatagattttgaatttgggtgtgctacatcatatattctcccagaactt
caggatgggctgtcttttcatgtttctattgccagaaacgataccgtttatattttggga
ggacactcacttgccagtaatatacgccctgctaacttgtatagaataagagtggacctt
cccctgggtaccccagcagtgaattgcacagtcttgccaggaggaatctctgtctccagt
gcaatcctcactcaaacaaacaatgatgaatttgttattgtgggtggttatcagctggaa
aatcagaaaaggatggtctgcagccttgtctctctaggggacaacacgattgaaatcagt
gagatggagactcctgactggacctcagatattaagcatagcaaaatatggtttggaagc
aacatgggaaacgggactattttccttggcataccaggagacaataagcaggctatgtca
gaagcattctatttctatactttgagatgctctgaagaggatttgagtgaagatcagaaa
attgtctccaacagtcagacatcaacagaagatcctggggactccactccctttgaagac
tcagaggaattttgtttcagtgctgaagcaaccagttttgatggtgacgatgaatttgac
acctacaatgaagatgatgaagatgacgagtctgtaaccggctactggataacatgttgc
cctacttgtgatgttgacatcaatacctgggttccgttctattcaacggagctcaataaa
cccgccatgatctattgttctcatggggatgggcactgggtacatgcccagtgcatggat
ttggaagaacgcacactcatccacttgtcagaaggaagcaacaagtattattgcaatgaa
catgtacagatagcaagagcattgcaaactcccaaaagaaacccccccttacaaaaacct
ccaatgaaatccctccacaaaaaaggctctgggaaagtcttgactcctgccaagaaatcc
ttccttagaagactgtttgattaa

DBGET integrated database retrieval system